(data stored in ACNUC7421 zone)

EMBL: CP001111.PE216

CP001111.PE216       Location/Qualifiers
FT   CDS_pept        262147..264021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0216"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: sme:SMc01492 probable
FT                   suppressor of E.COLI RpoH thermosensitive MUTATION
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49921"
FT                   /db_xref="GOA:B4SSN9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSN9"
FT                   /protein_id="ACF49921.1"
FT                   /translation="MAAKYCDLVMKGGITSGIVYPNAVLALAREYRFKSIGGTSAGAIA
FT                   AAVAAAAACGDRRQQAGEHLPGDAGYSGLSAVSAQLSRRGFIYSLFQPARGARAAYRLL
FT                   VVLTGNARLPHKLLCLAVAVFEIAPLEVLVSLSLLLGLGWWGGGWSGVAATLLPSLLCA
FT                   YGAGVAGAALRVARVARRNLLGLCSGLGRDARRPALTEWLHESLQQLSGKPLDAPLTFA
FT                   DLHDAPRYAGEPDSPHAISLQMITTCVSHNEPRTLPLGGAQFWFLREEFEQLFPASVVQ
FT                   WLVTQAGPPLEVEGRRYYHLPQGPKLPVLVATRMSLSFPLLISAVPLHEPSRRERRCEP
FT                   TAPAADQEHNVADSMEGLTSAGQTCGPVITAFRICWFSDGGISSNFPIHLFDAALPRWP
FT                   TFAINLVYPQHAEDVSHGSSGRQALEHAVFLPTENRHGWQRTYQSIATPLAAAELGRFL
FT                   FAVVATMQNWRDLLQARAPGYRDRIVHVSLQGDEGGMNLDMPQDVLTRIADKGSLAGAR
FT                   FCSFSFENHYWIRWRNLASAYQRYTLEVARTDDPAQQVLAYRAAYAMVASGQPAPPSYK
FT                   LGSEDKRLASQQLWGLMVEQGRSWDDLGPDLTDGAPRPLPQMKVTPIY"
     gtggcggcga agtactgcga tctggtcatg aaaggcggca tcaccagcgg catcgtgtat        60
     cccaatgcgg tactggcgct ggcccgcgaa tatcgtttca agagcatcgg cggcacctcg       120
     gccggcgcca tcgccgcggc ggtggcggcc gcggcggcgt gcggtgatcg ccgccagcag       180
     gcgggtgaac acctgcccgg cgatgcaggc tacagcgggc tgtcggcggt gtcggcgcag       240
     ctgtcgcggc gtggcttcat ctacagcctg ttccagccgg cgagaggcgc tcgtgcagcg       300
     tatcggctgc tggtggtgct gaccggcaat gcccgcctgc cgcacaagct gctgtgcctg       360
     gccgttgcgg tgttcgagat tgcaccgctg gaagtgctgg tatcgctgtc gctgctgctc       420
     ggcctgggct ggtggggcgg tggctggagc ggcgtggctg ccacgctgct gccatcactg       480
     ctgtgcgctt acggtgccgg cgtggccggt gccgcgctgc gggtggcccg ggtggcgcgg       540
     cgcaatctgc tgggcctgtg cagcggcctt ggccgtgatg cacgcagacc ggcattgacc       600
     gaatggttgc atgaaagcct gcagcagctg tccggcaagc cgctggatgc accgctcacc       660
     ttcgccgacc tgcacgatgc gccgcgctat gccggcgagc cggacagccc gcatgcaatc       720
     agcctgcaga tgatcaccac ctgcgtgtcg cacaacgagc cacgtacgtt gccgctgggt       780
     ggcgcgcagt tctggttcct gcgcgaggag ttcgagcagc tgttcccggc cagcgtggtg       840
     cagtggctgg tgacgcaggc cggcccgccg ctggaggtgg aggggcgccg gtactaccac       900
     ctgccgcagg ggccgaagct gccggtgctg gtggccacgc gcatgagcct gagcttcccg       960
     ttgctgatca gcgcggtgcc gctgcacgag ccctctcgcc gcgagcgtcg ctgcgaaccg      1020
     accgcacctg cggccgacca ggagcacaat gtggccgaca gcatggaagg gctgaccagt      1080
     gccgggcaga cctgtggccc ggtgatcacc gcattccgca tctgctggtt ctccgatggt      1140
     ggcatcagca gcaacttccc gatccacctg ttcgatgccg cgttgccgcg ctggccgacc      1200
     ttcgccatca atctggtcta cccgcagcac gccgaagacg tgagccacgg cagcagtggc      1260
     cgccaggcgc tggaacacgc ggtgttcctg cccaccgaga accgccacgg ttggcagcgt      1320
     acctaccagt cgatcgccac accgctggcc gctgcggagc tgggccgttt cctgttcgcg      1380
     gtggtggcga ccatgcagaa ctggcgcgac ctgctgcagg cgcgcgcgcc gggttaccgc      1440
     gaccgcatcg tgcatgtgag cctgcagggc gacgagggcg gcatgaacct ggacatgccg      1500
     caggacgtgc tgacccgcat cgccgacaag ggcagcctgg ccggtgcacg cttctgttcg      1560
     ttctcgttcg agaaccacta ctggatccgc tggcgcaacc tggcctcggc ctaccagcgc      1620
     tacacgctgg aagtggcgcg taccgatgac ccggcacagc aggtgctggc ctaccgcgca      1680
     gcgtatgcga tggtcgccag tggccagccg gcgccgccgt cgtacaagct gggctcggaa      1740
     gacaagcggc tggcctcgca gcagctgtgg ggattgatgg tcgagcaggg gcgcagctgg      1800
     gacgacctgg gcccggacct caccgacggt gcaccgcgcc cgctgccgca gatgaaggtg      1860
     acgccgatct attga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page