(data stored in ACNUC7421 zone)

EMBL: CP001111.PE218

CP001111.PE218       Location/Qualifiers
FT   CDS_pept        complement(265373..266740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0218"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: xac:XAC1311 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49923"
FT                   /db_xref="GOA:B4SSP1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP1"
FT                   /protein_id="ACF49923.1"
FT                   /translation="MNYSATQRQLGLRLLRLREQRGYSQAALAQALGLSASYLNQIERN
FT                   KRPLTPAVQKKLGEVLGDVSALFDDDEPAALQEALGETLRDLGLAEVSATELRALAGNL
FT                   PQVSRALLDLHRRHLALREHAAALEFQLGEPGAGSTLPAGDQVREFFNRMHNHIPELDE
FT                   LAEQLFAEWGLSPGHVAPRLRQLLADRHGVLVEVAALQAGREKRQYDAGARRLWLPDYL
FT                   EPGQQAFQMAAELALHGYLPQIDAVVARAGFTDDARIAQARIGLSNYFAGALVMPYMRF
FT                   LRAAEASSYDIELLAHQFGVGFEAVCHRLSTLARRSAPGLPFFFIRVDRAGNVSKRHSA
FT                   TDFHFSQVGGSCPLWIVYEAFNQPGRILTQTARMPDGRRHFWLARQVSSGPVGHGQPRK
FT                   TFAVALGCDLQHAERLVYSLGLDVQSPGNSVSIGPGCRVCPREDCMQRAFAQLPGR"
     gtgaattatt cagccaccca gcggcaactc ggccttcgcc tgctgcggct gcgcgaacag        60
     cgcggctaca gccaggcggc cctggcgcag gcgctggggc tgtcggccag ctacctgaac       120
     cagatcgagc gcaacaagcg tccactcacg ccggccgtgc agaagaagct gggcgaggtg       180
     ttgggcgatg tttccgccct gttcgacgac gatgagcccg ccgcgctgca ggaagcgctg       240
     ggcgagaccc tgcgcgacct gggcttggcc gaggtcagcg ccacggagct gcgcgcgctg       300
     gccggcaacc tgccgcaggt cagccgcgcg ctgctggacc tgcaccgccg ccacctggcg       360
     ctgcgcgagc atgccgccgc actggagttc cagctgggtg agcccggcgc cggcagcacc       420
     ttgcccgctg gcgaccaggt acgcgagttc ttcaaccgca tgcacaacca catccccgag       480
     ctggatgagt tggccgagca gctgttcgcc gagtgggggc tgtcaccggg gcatgtggca       540
     ccacggctgc gccagctgct ggccgaccgc catggcgtgc tggtggaggt ggccgcactg       600
     caggccgggc gcgaaaagcg ccagtacgac gccggtgcgc ggcggctgtg gctgcccgat       660
     tatctggagc ctggccagca ggcattccag atggccgccg agctggcact gcacggctac       720
     ctgccgcaga tcgatgcggt ggtggcgcgt gccggcttca ccgatgacgc gcgcatcgcg       780
     caggcacgga tcggtctttc caactatttc gccggcgcgc tggtgatgcc gtacatgcgc       840
     ttcctgcgtg cggccgaagc cagcagctac gacatcgaac tgctggcgca tcagttcggc       900
     gtcggcttcg aagcggtctg ccaccggctg agcacgctgg cacggcgcag cgcacccggc       960
     ctgccgtttt tcttcatccg ggtggaccgc gccggcaacg tatccaagcg ccactccgcc      1020
     accgatttcc acttctcgca ggtgggtggc tcgtgcccgc tgtggatcgt ctacgaggcg      1080
     ttcaaccagc cggggcgcat cctgacgcag accgcgcgca tgcccgatgg ccgccgccat      1140
     ttctggctgg cgcggcaggt cagcagcggg ccggtgggcc atggccagcc gcgcaagacg      1200
     ttcgcggtgg cgctgggctg cgatctgcag cacgccgagc ggctggtgta ttcactgggg      1260
     ctggatgtgc agagcccggg taattcggtg tcgatcggac cggggtgccg ggtgtgcccg      1320
     cgcgaggact gcatgcagcg cgcgttcgcg cagttgccgg ggaggtag                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page