(data stored in ACNUC7421 zone)

EMBL: CP001111.PE22

CP001111.PE22        Location/Qualifiers
FT   CDS_pept        26772..28865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0022"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: xcb:XC_0101 iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49727"
FT                   /db_xref="GOA:B4SR26"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR26"
FT                   /protein_id="ACF49727.1"
FT                   /translation="MNPAARRHCLPLSALLLSPLAAMAEPAPIALPAVQVQAARVPGID
FT                   PFALPASQDTVWIDAGRAGNSVQLSEALAGVPGLLARDRQNFAQDTQLSIRGFGARSTF
FT                   GVRGVRVLIDGVPATMPDGQGQLSHASLLGAERIEVLRGPFSALYGNSSGGVLQVWSAQ
FT                   GQASDPWRLRLNAGADNTLSIGAQLKGASHGLDYNIAANHFRTDGWREHSRARRESLTA
FT                   RIGGDLGGGRLELLLNALDAPDAQDPLGLTRAQVAADPRQATAVAHQYNTRKSVRQQQA
FT                   GLRWTRETDAQRWQLMGYAGQRAVRQYLPIPPAAQTNSPLHAGGVIDLEGGYGGLDARW
FT                   GWHGDLAGRPLDLVAGLSADRQRQHRTGYENFIGSALGVRGRLRRDQIDTVQNVDQFAQ
FT                   AWWQWSPRWSLLAGLRHSAVRFESDDRYITGRNPDDSGRRRYQATTPVAGVSFEASPQW
FT                   RLHAAVGRGFETPTFNELGYRADGQAGLALDLAAARSRNLEVGSKWHAQDGTQLDISLF
FT                   RADTDDELAVASNIGGRSTYRNIGRTRRQGVELQYRQPLAEQLELQLAWTWLQAQVRSP
FT                   YLTSNNVVAAGSRLPGVPRQQAFARLQWTPADWQWALEASASSDTVVNDVATERAPGYA
FT                   LLHVEGGRRWTLPGGELRAFARLENVLDQAYIGSVIVNDGNGRFYEPGPGRRASLGLQW
FT                   SWR"
     atgaatcccg ccgcacgacg ccactgcctg ccgttgtccg ccctgctgct gtcgccactg        60
     gcggccatgg ccgagcctgc gcccatcgcc ctgcccgccg tgcaggtgca ggcggcgcgg       120
     gtgccgggca tcgacccgtt cgcgctgccg gccagccagg acacggtctg gatcgacgcc       180
     ggccgggccg gcaacagcgt gcagttgtcc gaggcactgg ccggggtgcc gggactgctg       240
     gcgcgcgatc ggcagaactt cgcccaggac acgcagctgt cgatccgtgg ctttggcgcg       300
     cgctcgacct tcggtgtgcg cggcgtgcgg gtgttgatcg acggggtgcc cgcgaccatg       360
     cccgatggcc agggccagct gtcgcatgcc agcctgctgg gtgccgaacg catcgaggtg       420
     ctgcgcgggc cgttctcggc gctgtacggc aattcctccg gcggcgtgct gcaggtgtgg       480
     agcgcgcagg gccaggccag cgacccgtgg cggttgcgcc tcaacgcagg tgccgacaac       540
     acgctcagca tcggcgcgca gctgaaggga gccagccacg ggctggacta caacatcgcc       600
     gccaatcact tccgcaccga tggctggcgc gaacacagcc gcgcgcgccg cgaatcgctc       660
     accgcgcgca tcggcggcga tctgggcggt gggcgactgg agctgctgct caacgcgctg       720
     gatgcgccgg atgcgcagga cccgctgggc ctgacccgcg cgcaggtggc ggccgaccca       780
     cgccaggcca ctgcggtggc gcaccagtac aacacccgca aatcggtgcg ccagcagcag       840
     gccgggttgc gttggacccg cgaaaccgac gcccagcgct ggcaactgat gggctatgcc       900
     gggcagcgcg cggtgcgcca gtacctgccg attccgcctg cagcccagac caacagcccg       960
     ctgcatgccg gcggggtgat cgatctggag ggcggctacg gcggattgga cgcgcgctgg      1020
     ggctggcacg gcgacctcgc cggtcgaccg ctggatctgg tggccgggct cagtgcggac      1080
     cgccagcgcc agcaccgcac cggctacgag aacttcatcg gcagcgccct cggcgtgcgc      1140
     ggacgcctgc gccgcgacca gatcgacacg gtgcagaacg tggaccagtt cgcccaggcc      1200
     tggtggcagt ggagcccgcg ctggtcgctg ctggccgggc tgcgccacag cgcggtgcgc      1260
     ttcgaatccg atgaccgcta catcaccggg cgcaatccgg acgacagcgg ccgccgacgc      1320
     taccaggcga ccacgccggt ggcaggcgtc agcttcgaag ccagcccgca gtggcggctg      1380
     cacgcggccg tggggcgtgg tttcgagacc cccaccttca acgaactggg ttatcgcgcc      1440
     gacggccaag cgggattggc actggatctg gcggccgcgc gcagccgcaa tctggaggta      1500
     ggcagcaaat ggcacgcaca ggacggaacc cagcttgata tcagcctgtt ccgcgcagat      1560
     accgacgatg agttggccgt tgccagcaac atcggcgggc gcagtaccta ccgcaatatc      1620
     ggtcgcaccc gtcgccaagg cgtggaacta cagtatcgcc agcccttggc cgagcagctg      1680
     gaactgcagc tggcatggac ctggctgcag gcgcaggtgc gctcgccgta cctgacctcg      1740
     aacaacgtgg tcgccgcggg cagccgtctg cctggtgtgc cgcgccaaca ggccttcgcc      1800
     cggctgcagt ggacacccgc tgactggcag tgggcgctgg aggcgtccgc cagcagcgat      1860
     accgtggtca acgacgtggc caccgagcgc gcgccaggct acgcgctgct gcacgtggaa      1920
     ggcggccgcc gctggaccct gccgggcggc gagctgcgtg ccttcgcgcg gttggagaac      1980
     gtgctggacc aggcctacat tggctcggtg atcgtcaatg acggcaatgg ccgcttctac      2040
     gagccgggac cgggacgacg ggccagcctc gggctgcagt ggtcgtggcg ttga            2094
//

If you have problems or comments...

PBIL Back to PBIL home page