(data stored in ACNUC7421 zone)

EMBL: CP001111.PE220

CP001111.PE220       Location/Qualifiers
FT   CDS_pept        268376..269542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0220"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: xac:XAC1313
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49925"
FT                   /db_xref="GOA:B4SSP3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSP3"
FT                   /protein_id="ACF49925.1"
FT                   /translation="MSHSMTTELEEAQQAYREAARDFAQAELAPHAARWDAEGIFPREA
FT                   IAKAGELGFCGLYMDPEVGGSGLSRLDAAVVIEELANVDPSTAAYISIHNMASWMVSKW
FT                   GQPALRDAWGTDLSSGSKLASYCLTEPGAGSDAASLKTTAVRDGDFYVLNGSKAFISGA
FT                   GATELLVVMARTGGAGAGGVSAIAVPADLPGISFGRKEEKMGWNSQPTRGITFENVRVP
FT                   VSHLLGEEGGGFKLAMKGLDGGRINIAACSLGAAQGALDAARRYMGERRQFGKTLSEFQ
FT                   ALQFKLADMAIELVAARQMVHTAARKLDAGASDANVWCAMAKRFATDAGFNICNEALQI
FT                   HGGYGYIREYPIERLLRDSRVHQILEGTNEIMRVIVARHLLNTEEELR"
     atgagccact cgatgacgac ggaactggaa gaagcgcagc aggcgtaccg cgaggcggcg        60
     cgcgacttcg cacaggccga actggcgccg cacgccgcgc gatgggatgc ggagggcatc       120
     tttccgcgcg aggcgatcgc caaggccggt gaactgggct tctgcggcct gtacatggac       180
     ccggaagtgg gcggcagcgg cctgagccga ctggacgccg ccgtcgtcat cgaggagctc       240
     gccaacgtcg atccgtcgac cgcggcgtac atcagcatcc acaacatggc gtcgtggatg       300
     gtgtccaagt ggggccagcc ggcgctgcgc gacgcgtggg gaaccgatct gtcctcgggc       360
     agcaagctgg cctcgtactg cctgaccgaa ccgggtgcag gttccgatgc ggcctcgttg       420
     aagaccaccg ccgtgcgcga cggtgacttc tatgtgctga acggctccaa ggccttcatt       480
     tccggcgccg gtgccaccga actgctggtg gtgatggcgc gtaccggtgg tgccggtgcc       540
     ggtggtgtca gcgcgatcgc ggtgccggcc gacctgccgg gcatcagctt cggccgcaag       600
     gaagagaaga tgggctggaa cagccagccc acccgcggca tcaccttcga gaacgtccgc       660
     gtgccggtca gccaccttct gggagaggaa ggcggcggct tcaagctggc gatgaagggg       720
     ctcgatggcg gccgcatcaa catcgccgcc tgctcgctgg gcgctgcgca gggggcgctg       780
     gatgccgcac gccgctacat gggcgagcgc cgtcagtttg gcaagaccct gtccgaattc       840
     caggcgctgc agttcaagct ggccgacatg gccatcgaac tggtggccgc acggcagatg       900
     gtgcacaccg ccgcgcgcaa gctcgatgcc ggcgccagcg atgccaacgt gtggtgcgcg       960
     atggccaagc gcttcgccac cgatgctggc ttcaacatct gcaacgaagc actgcagatc      1020
     cacggtggct acggctacat ccgcgaatac ccgatcgaac gcctgctgcg cgattcgcgc      1080
     gtgcaccaga tcctggaagg caccaacgag atcatgcggg tgatcgttgc ccgtcacctg      1140
     ctcaacaccg aagaggaact gcgatga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page