(data stored in ACNUC7421 zone)

EMBL: CP001111.PE228

CP001111.PE228       Location/Qualifiers
FT   CDS_pept        277727..278101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49933"
FT                   /db_xref="UniProtKB/TrEMBL:B4SSQ1"
FT                   /protein_id="ACF49933.1"
FT                   /translation="MSSAPFHRRIALATCVVLAAAPLSSALAQQPPRGDQGRAEMMERG
FT                   ERGGRGDERSLSDAVRRVQRTTGGHILGAERVPFDGRDINRVKYMDDRGRVRYMDDPAP
FT                   SRSQPRTPRSDMSSLRGDNP"
     atgtcttccg ctcccttcca tcgccgcatt gccctggcca cctgcgtggt gctggcggct        60
     gcgccgctgt cttcggcgct ggcgcaacag ccgccgcgcg gcgaccaggg gcgggcggag       120
     atgatggagc ggggtgagcg cggtggccgt ggcgacgagc gttcgctgtc cgatgccgtg       180
     cgccgcgtgc agcgcaccac cggcggccac atcctcggcg ccgagcgcgt gccgttcgat       240
     ggtcgtgata tcaaccgggt gaagtacatg gacgatcggg gccgggtccg ctacatggac       300
     gaccctgcgc cgtcgcgttc acagccgcgc acgccgcggt cggatatgtc atcactacgc       360
     ggcgataacc cctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page