(data stored in ACNUC7421 zone)

EMBL: CP001111.PE229

CP001111.PE229       Location/Qualifiers
FT   CDS_pept        278175..278858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0229"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: xom:XOO_0385 two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49934"
FT                   /db_xref="GOA:B4ST91"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST91"
FT                   /protein_id="ACF49934.1"
FT                   /translation="MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPF
FT                   DVGIIDLGLPKMSGMELIKALRDEGKKFPVLILTARSSWQDKVEGLKQGADDYLVKPFH
FT                   VEELLARVNALLRRAAGWSKPTLECGPVALDLAAQTVSVAGSNVDLTSYEYKVLEYLMM
FT                   HAGELVSKADLTEHIYQQDFDRDSNVLEVFIGRLRKKLDPDGELKPIETVRGRGYRFAI
FT                   PRNEG"
     atgcgtatcc ttctggtcga agacgaagcc ccgctgcgtg agaccctggc agcccggctc        60
     aagcgcgaag gctttgccgt cgatgctgcg caggacggcg aggaaggcct ctacatgggg       120
     cgcgaagtcc cgttcgatgt cggcatcatc gacctcggcc tgcccaagat gtcgggcatg       180
     gagctgatca aggccctgcg ggacgaaggc aagaagttcc cggtgctgat cctgaccgcg       240
     cgttcgagct ggcaggacaa ggtcgagggc ctgaagcagg gtgccgacga ttacctggtc       300
     aagccgttcc acgtcgaaga gctgctggcc cgcgtcaatg cgctgctgcg ccgcgccgct       360
     ggctggagca agccgacgct ggaatgcggc ccggttgcgc tggatctcgc cgcccagacc       420
     gtcagtgtgg ccggcagcaa tgtcgacctc accagctacg agtacaaggt gctggagtac       480
     ctgatgatgc atgccggtga actggtctcc aaggccgacc tcaccgagca catctaccag       540
     caggacttcg accgcgactc gaacgtgctg gaggtcttca tcggccgcct gcgcaagaag       600
     ctggacccgg atggcgagct gaagccgatc gagaccgtgc gcggacgcgg ctaccgtttc       660
     gcgattccgc gcaacgaggg ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page