(data stored in ACNUC7421 zone)

EMBL: CP001111.PE232

CP001111.PE232       Location/Qualifiers
FT   CDS_pept        complement(281157..281441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0232"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV4111 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49937"
FT                   /db_xref="UniProtKB/TrEMBL:B4ST94"
FT                   /protein_id="ACF49937.1"
FT                   /translation="MRRYAHCLILLMMPFAASATAALDDSRGACVSSNGDAASQRAPTA
FT                   TTSAATTKPAPVRPAASSATSTGGGGSDDDVLQRIRAPKWHSYLPGMFR"
     atgcgccgtt atgcccattg cctgatcctg ctgatgatgc ccttcgcggc gtctgcgaca        60
     gcagcgctgg acgacagccg cggcgcctgc gtgtcttcca acggtgatgc cgcctcgcag       120
     cgcgcaccga ccgcaaccac ctcggcagcc accaccaagc cggcaccggt acgcccggcc       180
     gccagcagcg ccaccagcac cggtggcggt ggcagcgacg acgacgtgct gcagcgcatc       240
     cgcgcaccga agtggcacag ctacctgccg ggaatgttcc gctga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page