(data stored in ACNUC7421 zone)

EMBL: CP001111.PE234

CP001111.PE234       Location/Qualifiers
FT   CDS_pept        282551..283282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0234"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: xcb:XC_4025 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49939"
FT                   /db_xref="GOA:B4ST96"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4ST96"
FT                   /protein_id="ACF49939.1"
FT                   /translation="MSDWLFDLGNSRFKFAPLQGDRAGDVQAWAHGAEGMAGQPPHSLP
FT                   SGTTAFVASVAAPSLTSAMLDQLQRRFEHVHVVRTSAECAGVRIAYAKPEKFGVDRFLA
FT                   LLAAAKAQRPVLVVGVGTALTIDLLDANGQHHGGRISASPTTMREALHARAVQLPATGG
FT                   DYSEFANDTADALASGCDGAAVALIERSAQQAHALLGVAPSLLVHGGGAPALMPLLPGA
FT                   DYHPSLVLDGLARWAVHQPAG"
     atgagcgatt ggttgttcga cctgggcaac tcgcgcttca agttcgcgcc gttgcagggt        60
     gaccgcgccg gcgacgtgca ggcctgggcg cacggcgccg aaggcatggc cggacagccg       120
     ccgcacagcc tgcccagcgg caccaccgcg ttcgtggcca gcgtggccgc accctcgctg       180
     accagcgcca tgctggacca gctgcagcgc cgcttcgagc acgtgcatgt cgtgcgcacc       240
     agcgccgaat gcgcgggcgt gcgcattgcc tatgccaagc cggaaaaatt cggcgtcgac       300
     cgcttcctgg ccctgctggc tgcggccaag gcgcagcgcc cggtgctggt ggtcggcgtg       360
     ggcaccgcac tgacgattga tctgctcgac gccaatggcc agcatcacgg cgggcgcatt       420
     tccgcatcgc ccaccaccat gcgcgaagcg ctgcacgccc gtgccgtgca gctgcccgct       480
     accggtggtg actacagcga gttcgccaac gacactgccg acgcgctggc ctccggctgc       540
     gacggcgcgg ccgtggcgct gatcgaacgc agtgcacagc aggcgcacgc gctgctgggc       600
     gtggcaccgt cgctgctggt gcacggtggt ggcgcaccgg cgctgatgcc gttgctgccc       660
     ggcgccgatt accacccgtc gctggtgctg gatggcctcg cccgctgggc ggtgcaccag       720
     cccgcaggct ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page