(data stored in ACNUC7421 zone)

EMBL: CP001111.PE240

CP001111.PE240       Location/Qualifiers
FT   CDS_pept        287315..287536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0240"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: xac:XAC4007
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49945"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA2"
FT                   /protein_id="ACF49945.1"
FT                   /translation="MNKDIISGKWSQLKGKAQAKWGDLTNDDFDVAEGNAEYLAGRLQE
FT                   RYGWAKDRAEKEVREFQDSVSKDYPDYK"
     atgaacaaag acatcatttc cggcaagtgg tcgcagctga agggcaaggc ccaggccaag        60
     tggggcgatc tgaccaacga cgatttcgat gtggccgagg gcaatgccga gtatctggcc       120
     ggtcgcctgc aggaacgtta tggctgggcc aaggaccgcg ctgagaagga agtccgtgag       180
     ttccaggaca gcgtgagcaa ggactacccg gactacaagt aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page