(data stored in ACNUC7421 zone)

EMBL: CP001111.PE241

CP001111.PE241       Location/Qualifiers
FT   CDS_pept        complement(287610..288410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afw:Anae109_3503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49946"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA3"
FT                   /protein_id="ACF49946.1"
FT                   /translation="MKRLLPLLLILPLAGFRPAPMPPPVYEGGPVRMALVDRDRGTELR
FT                   AYPADGQRWVAGERGHRYAVRLYNDSPRRVLVVLSVDGVNAISGEDADPSQTGYVLNPG
FT                   QRADITGWRKSQDEVAQFVFSSPSGSYASRTGRPDNIGVVGVAVFEEARRWYPQPILRR
FT                   GLPAPAPAAEAAADASASNSRIEGYASKSQSPALGTGHGAREQSSVRDTDFERASRSPA
FT                   QVLQLRYDSARNLRARGILVDSPSRLPREPQAFPNRYVPDPPAR"
     atgaaacgcc tgctgcccct gctgctgatc ctgcccctgg ccggcttccg tccggctccg        60
     atgccgccgc cggtgtacga gggcggcccc gtgcgcatgg ccctggtcga ccgcgaccgc       120
     ggtactgaac tgcgcgccta cccggccgac ggccagcgct gggtggccgg cgaacgcggc       180
     caccgctacg ccgtgcgcct gtacaacgac agcccgcgcc gggtgctggt ggtgctgtcg       240
     gtggacggcg tcaatgccat ctccggcgag gatgccgatc cctcgcagac cggctacgtg       300
     ctcaaccccg gccagcgcgc cgacatcacc ggctggcgca agagccagga cgaagtggcg       360
     cagttcgtgt tcagcagccc cagcggcagc tatgccagcc gcaccggccg cccagacaat       420
     atcggcgtgg tgggcgtggc ggtgttcgag gaagcgcgac gctggtaccc gcagccgatc       480
     ctgcgccgtg gcctgccagc accggccccg gcggccgaag cagcggccga tgccagcgcc       540
     agcaacagcc gcatcgaggg ctacgccagc aagtcgcagt cgccagcgct gggcaccggc       600
     cacggtgcac gcgagcagtc ttcggtgcgc gataccgact tcgaacgcgc cagccgcagc       660
     ccggcgcagg tcctgcagct gcgctacgac agcgcccgca acctgcgcgc acgcggcatc       720
     ctggtggact ccccctcccg cctaccgcgc gaaccgcagg cgttccccaa ccgctacgtg       780
     ccggacccgc cggcgcgttg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page