(data stored in ACNUC7421 zone)

EMBL: CP001111.PE243

CP001111.PE243       Location/Qualifiers
FT   CDS_pept        289950..290252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49948"
FT                   /db_xref="GOA:B4STA5"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA5"
FT                   /protein_id="ACF49948.1"
FT                   /translation="MAWLSLLLFLPWFLLLGSLYWLFPRQPRTARRRLFDGAALALALL
FT                   LSILAMLWGHHIGLVQPGAGPIWPQVLAVLYAYGAFLAVLVLALLLRPRFALRCD"
     atggcctggt tgtcgctgct gctgttcctg ccctggtttc tgttgctggg cagcctgtac        60
     tggctgttcc cgcgccagcc gcgtaccgcg cgacggcgcc tgttcgatgg tgctgccctg       120
     gcattggcat tgctgctgag catcctggcg atgctctggg gccaccacat cggcctggtg       180
     cagcccggcg ccggcccgat ctggccgcag gtgctggcgg tgctgtatgc ctacggcgcg       240
     ttcctggcgg tgctggtgtt ggccctgttg ctgcggccgc ggttcgcatt gcgctgcgac       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page