(data stored in ACNUC7421 zone)

EMBL: CP001111.PE246

CP001111.PE246       Location/Qualifiers
FT   CDS_pept        complement(293225..293578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49951"
FT                   /db_xref="GOA:B4STA8"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA8"
FT                   /protein_id="ACF49951.1"
FT                   /translation="MIAATGAMPVAAASPATPLMWIAATLAAATALAWLLRRPNAQAAW
FT                   PRIGFGIALLVFCAALALQLAVDLGSGHSSLQMRLHRGISPGSPVGLRTMVACYLAALV
FT                   ASGWGAWKLLRRR"
     atgatcgcgg ccaccggtgc aatgccggtg gccgctgcgt ctcccgccac gccattgatg        60
     tggatcgcgg cgacgctggc cgcagccacg gcactggcct ggctgctgcg ccgccccaac       120
     gcgcaggccg cgtggccgcg catcggtttc gggatcgccc tgctggtgtt ctgcgccgcg       180
     ctggcgctgc agctggcggt ggacctgggc agcggccaca gctcgctgca gatgcgcctg       240
     catcgcggca tctctccagg gtcgccggtt ggactgcgca cgatggtggc gtgctatctg       300
     gcagcactcg tcgccagtgg ctggggtgcg tggaagctgc tgcgccggcg ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page