(data stored in ACNUC7421 zone)

EMBL: CP001111.PE247

CP001111.PE247       Location/Qualifiers
FT   CDS_pept        complement(293589..294923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0247"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: xcb:XC_4259
FT                   dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49952"
FT                   /db_xref="GOA:B4STA9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4STA9"
FT                   /protein_id="ACF49952.1"
FT                   /translation="MSTTSHSAVPSTDGAALRRSISNTLKGSAGNLVEWYDVYVYSVFA
FT                   VYFESQFFSPDDKNSTMYVWAIFAATFLMRPIGAWFFGRFADRHGRRQALTVSVTLMAA
FT                   CSFLIAITPTAASIGIWAAVILLFARLLQGFATGGEYGASATYMSEAAIPGRRGFLSSF
FT                   HYVTLVGGHVLAQLTLLLMLTFWGKPEISEWGWRIAFGIGGIAAVVVFWLRRGMDESLS
FT                   ESSIEAAREGKAQKSGSMYELFVHQWRPLLLCFLITAGGTVAFYTYSVNGPKMIQSAFA
FT                   ANDPMTGTLINLGVLAFLMVLQPVGGWLSDIIGRKTLLVFFGVGGVLYSWYLITQLPHQ
FT                   HDATLAFLTLALGFVILTGYTSINAVVKAELFPTHVRALGVGLGYALANSLFGGTAPLL
FT                   YQGALKTGHVDWFAIYVTATIAVSLVVYVFFLTNKGPNWLDGTRK"
     atgagcacca cgtcccattc cgctgtcccc agcaccgacg gcgccgcgct gcggcgttcc        60
     atctccaata ccctcaaagg ctccgccggc aacctggtgg agtggtacga cgtctacgtg       120
     tactcggtat tcgccgtgta cttcgaatcg cagttcttct cgccggatga caagaactcc       180
     acgatgtacg tgtgggcgat cttcgcggca accttcctga tgcgcccgat cggcgcctgg       240
     ttcttcggcc gcttcgccga ccgccatggc cgtcgccagg ccctgaccgt gtcggtcacg       300
     ctgatggcgg cctgctcgtt cctcatcgcc atcaccccca ccgccgccag catcggtatc       360
     tgggcagcgg tgatcctgct gttcgcacgg ctgctgcagg gcttcgccac cggcggcgag       420
     tacggtgcca gtgccaccta catgtccgag gccgccatcc ccggccgtcg cggcttcctg       480
     tcttccttcc actacgtcac cctggtcggt ggccatgtgc tggcccagct gacgctacta       540
     ctgatgctga ccttctgggg caagccggaa atctccgagt ggggctggcg catcgccttc       600
     ggcatcggtg gcatcgcggc agtggtggtg ttctggctgc gtcgtggcat ggacgagtcg       660
     ctgtcggagt cgtccatcga ggccgcacgc gagggcaagg cacagaagtc cggctcgatg       720
     tacgagctgt tcgtgcacca gtggcggccg ctgctgctgt gcttcctgat caccgccggt       780
     ggcaccgtgg ccttctacac ctactcggtg aacggcccga agatgatcca gagtgccttc       840
     gccgccaatg atccgatgac cggcaccctg atcaacctgg gcgtgctggc cttcctgatg       900
     gtgctgcagc cggtcggtgg ctggctgtcg gacatcatcg gccgcaagac cctgctggtg       960
     ttcttcggcg tcggcggcgt gctgtacagc tggtacctga tcacccagct gccgcaccag      1020
     catgacgcca ccctggcatt cctgaccctc gcgctgggct tcgtcatcct caccggctac      1080
     acctcgatca acgcggtggt gaaggccgaa ctgttcccca cccacgtgcg tgcactgggc      1140
     gtgggcctgg gctatgcact ggccaactcg ctgttcggcg gcaccgcccc gctgctgtac      1200
     cagggcgcgc tgaagaccgg ccacgtggac tggttcgcca tctacgtcac cgcgacgatc      1260
     gcggtatcgt tggtggtcta tgtgttcttc ctcaccaaca agggcccgaa ctggctcgac      1320
     ggcacccgca agtaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page