(data stored in ACNUC7421 zone)

EMBL: CP001111.PE248

CP001111.PE248       Location/Qualifiers
FT   CDS_pept        295236..296141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0248"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: xac:XAC4003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49953"
FT                   /db_xref="GOA:B4STB0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB0"
FT                   /protein_id="ACF49953.1"
FT                   /translation="MSAPPVPSAAAPRGGLVALALLLVYVVWGSTYLGIAKALHGGALP
FT                   LTMVSGSRFIIAGGLMFLALRLFWKMPNPTLRQWRNLVIMGVTMLVLGNGMVVLAEREV
FT                   SSGLAATAVASVPLWMALFSALRGQHASKGEWLGIAVGFVGVVWLNAGSSLTASPTGLV
FT                   LLLIAPIGWAFGSVWARGLDLPGPFMTAAGQMLCGGVLLVLIGLAVGERPTTLPDTGGL
FT                   LAMAYLCVFGSIVAFTAYVWLLQNVRPALAGSYAYVNPVIAVLLGAALNGERFGWRDFL
FT                   AMAVILLGVVVLTMARTRKK"
     atgtcggctc cccctgttcc gtctgcggct gccccccggg gtggccttgt cgcgttggcg        60
     ctgctgctgg tctacgtggt ctgggggtcg acctacctgg gcatcgccaa ggccctgcac       120
     ggcggcgcgc tgccgctgac gatggtctcc ggcagccgct tcatcattgc cggtggcctg       180
     atgttcctgg ccctgcgcct gttctggaag atgccgaacc cgaccctgcg gcagtggcgc       240
     aacctggtca tcatgggcgt gaccatgctg gtgctgggca acggcatggt ggtgctggcc       300
     gagcgcgagg tgtcctcggg cttggcggcc accgcggtgg cttcggtgcc gctgtggatg       360
     gcactgttct cggcgctgcg cggccagcat gccagcaagg gcgaatggct gggtatcgcc       420
     gtcggcttcg tcggcgtggt ctggctcaat gccggcagca gcctgaccgc ctcgccgacc       480
     gggctggtgc tgctgctgat cgcgccgatc ggctgggcct tcggttcggt gtgggcacgc       540
     gggctggatc tgccgggccc gttcatgacc gccgccggtc agatgctctg cggcggcgtg       600
     ctgctggtgc tgatcggcct ggccgttggc gagcggccga ccacgctgcc cgataccggc       660
     ggtctgctgg cgatggccta cctgtgcgtg ttcgggtcca tcgtggcgtt caccgcctat       720
     gtgtggctgc tgcagaacgt acgcccggcg ctggccggca gctatgcata cgtcaatccc       780
     gtgatcgcgg tgctgctggg cgccgcattg aatggtgaac gctttggatg gcgggacttc       840
     ctcgccatgg cggtgattct tctgggtgtg gtggtgttga cgatggcgag gacgcgaaag       900
     aaatga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page