(data stored in ACNUC7421 zone)

EMBL: CP001111.PE25

CP001111.PE25        Location/Qualifiers
FT   CDS_pept        30139..31044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0025"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   xcb:XC_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49730"
FT                   /db_xref="GOA:B4SR29"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR29"
FT                   /protein_id="ACF49730.1"
FT                   /translation="MARPIWTGTLSFGLLNVPVSLMSGERKVDLQFRMLDSRDRKPIRF
FT                   ERVNADTGEEVPWKDIVKAYEYDKGSYVVLEEGDIRSAAPESHEAVEVESFVDAAQIDP
FT                   RYYEKPYLLVPGKKAEKGYVLLRETLRSTGKVGIARVVVRTREYLCAVMPHEDALVLMI
FT                   LRYPQELVDPEDYKLPTGKLSDYRITSKETAMAEQLIESMAGDWDPSQYHDEFRERLQL
FT                   VLNKRIKSKGGTTRVEDEPSPREDATTNVVDFMALLQKSLDANKRTPAKKTATRKAPAK
FT                   KAAKKAAKKAVKKTTRRKAG"
     atggctcgcc cgatctggac cggcacgctg tcgtttggcc tgctcaacgt gccggtgtct        60
     ctgatgtccg gcgaacgcaa agtcgatctg cagttccgca tgctcgactc ccgtgaccgc       120
     aagccgatcc gcttcgagcg ggtcaacgcc gataccggcg aggaggtgcc gtggaaggac       180
     atcgtcaaag cctacgagta cgacaagggc agctacgtcg tgctggagga aggcgatatc       240
     cgttcggccg cgccggaaag ccacgaagcg gtggaagtgg aatcgttcgt ggacgcggcg       300
     cagatcgacc cgcgttacta cgagaaaccg tatctgctgg tacccggaaa gaaggccgaa       360
     aagggctacg tgctgctgcg cgagacattg cgcagtaccg gcaaggtggg catcgcgcgg       420
     gtggtggtgc gcacgcgcga atacctgtgc gcggtgatgc cgcatgagga cgcgctggtg       480
     ctgatgatcc tgcgctatcc gcaggagctg gtggatcccg aggactacaa gctgcccacc       540
     ggaaaactgt ccgactaccg catcaccagc aaggaaacag cgatggccga acagctgatc       600
     gagtcaatgg ccggtgactg ggatccttcg cagtatcacg atgagttccg cgagcgtctg       660
     cagctggtat tgaacaagcg catcaaatcc aagggcggca ctacccgggt ggaagacgag       720
     ccctcaccgc gtgaagatgc caccaccaat gtggtggatt tcatggcgtt gctgcagaag       780
     agcctggacg ccaacaagcg cacgcccgcg aagaagacgg caacgcgcaa ggcaccggcg       840
     aagaaggctg cgaagaaggc cgccaaaaag gccgtgaaga agaccacccg gcgcaaggca       900
     ggttga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page