(data stored in ACNUC7421 zone)

EMBL: CP001111.PE251

CP001111.PE251       Location/Qualifiers
FT   CDS_pept        complement(300495..301817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0251"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   xom:XOO_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49956"
FT                   /db_xref="GOA:B4STB3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB3"
FT                   /protein_id="ACF49956.1"
FT                   /translation="MFKSKLKKWLGNALTALLLVIGLVLWIGLPWIGVLAVAVLVALWL
FT                   LLTRGGRLALAATRIGVASLPQRWGASSVIVVGIAGVVGVLVAMLAMGEGFQATLNNTG
FT                   DDTTAIVLRGGSQAETNSVITREQVPTLSTLPGISRDAEGRPLLSPELSQVVNLVSKSD
FT                   GTDVNAQFRGVGPQAWAVHDKVKIVEGRTFATGLREIVVGQGAKGQFRDLDVGKTLTLG
FT                   NQTWTVVGVFATGDAHDSELWTDADTLATTYQRSAWQSISVRTDGKPGFEQFKAAVAAD
FT                   PRLKLDVETTRVYYSKQGGGLTKLIDILGKVIGTIMAVGAVFGALNTMYAAVATRAREI
FT                   ATMRAIGFRGLPVVTAVMLETMLLALLGGLLGCAVAWLLFNGYSVSTIGSNFSAVVFKF
FT                   HVSSELLWTGLKWALGIGLVGGLFPALRAARLPITTALRET"
     atgttcaaga gcaaactcaa gaagtggctg ggcaatgcgc tgaccgcgct gctgctggtg        60
     atcggcctgg tgctgtggat cggcctgccg tggatcggcg tgttggcggt cgccgtgctg       120
     gtggcactgt ggctgctgct gacccgcggt gggcgactgg cgctggccgc cacccgcatc       180
     ggcgtagcca gtctgccgca gcgctggggc gcgtcctcgg tgatcgtggt cggcatcgcc       240
     ggcgtggtcg gcgtgctggt ggcgatgctg gcgatgggcg aaggcttcca ggccacgctc       300
     aacaacaccg gcgatgacac caccgccatc gtgctgcgcg gcggctcgca ggccgaaacc       360
     aactcggtca tcacccgcga gcaggtgccg acgttgtcca ccctgcccgg catcagccgc       420
     gatgccgaag gccggccgct gctgtcaccg gagttgtcgc aggtggtcaa cctggtgtcg       480
     aagtccgatg gcaccgacgt caacgcgcag ttccgcggcg tcggcccgca ggcgtgggcg       540
     gtgcatgaca aggtcaagat tgtcgaaggc cgcacgttcg ccaccggcct gcgcgagatc       600
     gtggtcggcc agggcgccaa gggccagttc cgcgatctgg atgtgggcaa gacgctgacg       660
     ctgggcaacc agacctggac cgtggtcggt gtgttcgcca ccggcgatgc gcatgactcg       720
     gaactgtgga ccgacgccga tacgctggcc accacctacc agcgcagtgc gtggcagtcg       780
     atcagcgtgc gcaccgatgg caagcccggc ttcgagcagt tcaaggccgc cgtcgctgcc       840
     gacccgcgcc tgaaactgga cgtggaaacc acccgcgtct actacagcaa gcagggcggt       900
     ggcctgacca agctgatcga catcctcggc aaggtgatcg gcaccatcat ggcggtgggt       960
     gcggtgttcg gtgcgctcaa caccatgtac gcagcggtgg ccacgcgtgc gcgcgagatc      1020
     gccacgatgc gggcgatcgg cttccgcggc ctgccggtgg tgactgcagt gatgctggaa      1080
     acaatgctgc tggccctgct gggtggcctg ctggggtgtg cggtggcgtg gctgctgttc      1140
     aatggttaca gcgtgtccac catcggcagc aacttcagcg cggtggtgtt caagttccat      1200
     gtgtcgtcgg aactgctgtg gaccggcctg aaatgggcac tgggcatcgg cctcgtcggc      1260
     ggcctgttcc cggcgctgcg cgcggcacgg ttgcccatca ccacggcgtt gcgcgaaacc      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page