(data stored in ACNUC7421 zone)

EMBL: CP001111.PE252

CP001111.PE252       Location/Qualifiers
FT   CDS_pept        complement(301831..302988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0252"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   xom:XOO_0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49957"
FT                   /db_xref="GOA:B4STB4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB4"
FT                   /protein_id="ACF49957.1"
FT                   /translation="MKYFSLVWAQLFRTRTRTLLTLLSVVAAFLLFGMLDSVRVAFTSG
FT                   GSVEGANRLVTASRLSITQSLPIRLETQIRQVAGVRDVAYGMWFGGIYQDPKNFFPNFS
FT                   VSPNYFDVYRELQIDPAQLEDWKNTRTGAIVGETLAKQFGWKIGDTIPLQATIFPRGGS
FT                   NDWPLELKGIYRSRDPAQASNEERQLMMNWKYFDESNDYIKNQVSWYTVTLDNPDHSSR
FT                   VAQAIDAISANSDHETKTQTESAFQQAFVKQFADIGMIVTSIMGAVFFTLLLLTGNTMA
FT                   QAVRERVPELATLKTLGFKDSTVLMLVMVESVLLIGLGGLIGMGLAALILPAIGPKSMG
FT                   MLPPHVPTPTWLMGLGLIVVIGIIVGLLPALRAKRLKIVDALAGR"
     atgaaatact tctcgttggt ctgggcgcag ctgttccgca cccgcacccg caccttgttg        60
     accctgctgt cggtggtggc cgcgttcctg ctgttcggca tgctcgattc ggtgcgcgtg       120
     gcgttcacct ccggtggtag cgtggaaggt gccaaccggc tggtcactgc ctcgcgcctg       180
     tcgatcaccc agtcgctgcc gatccgcctg gaaacgcaga tccgccaggt cgccggtgta       240
     cgcgacgtgg cctatggcat gtggttcggc ggcatctacc aggacccgaa gaatttcttc       300
     ccgaacttct cggtgtcacc caactacttc gatgtctacc gcgaactgca gatcgacccg       360
     gcgcagctgg aagactggaa gaacacccgc accggcgcca tcgtcggcga gaccctggcc       420
     aagcagttcg gctggaagat cggcgacacc attccgctgc aggcgacaat cttcccgcgc       480
     ggcggcagca acgactggcc gctggagttg aagggcatct accgttccag ggatccggca       540
     caggcctcca acgaagaacg ccagttgatg atgaactgga agtacttcga tgagtccaac       600
     gactacatca agaaccaggt gagctggtac acggtgacgc tggacaaccc ggaccactct       660
     tcgcgggtgg cgcaggcgat cgacgcgatc tcggccaact ccgaccacga aaccaagacc       720
     cagaccgaat cggcgttcca gcaggccttc gtcaagcagt tcgccgacat cggcatgatc       780
     gtcacctcga tcatgggtgc ggtgttcttc accctgctgc tgttgaccgg caacaccatg       840
     gcgcaggcgg tgcgcgagcg cgtgcccgaa ctggccacgc tgaagacgct gggcttcaag       900
     gacagcaccg tgctgatgct ggtaatggtg gagtcggtgc tgctgatcgg cctcggtggc       960
     ctgatcggca tgggcctggc tgcactgatc ctgccggcga tcgggccaaa gagcatgggc      1020
     atgctgccgc cgcacgtgcc gacgccgacc tggctgatgg ggctgggcct gatcgtggtg      1080
     atcggcatca tcgtcggcct gctgccggcg ctgcgtgcca agcgcctgaa gatcgtcgac      1140
     gcactggccg gccgctga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page