(data stored in ACNUC7421 zone)

EMBL: CP001111.PE254

CP001111.PE254       Location/Qualifiers
FT   CDS_pept        complement(303795..305048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0254"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   xcv:XCV4088 membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49959"
FT                   /db_xref="GOA:B4STB6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB6"
FT                   /protein_id="ACF49959.1"
FT                   /translation="MNASAELLKELRIDRKSPPPASGGSGSGGGRRWLWIAIIVIVLLL
FT                   AAAAFALFGRTPAVDVETAPAVAIQQGNASSSVLDASGYVVARRMATVSAKITGKVREV
FT                   MIEEGMRVEQGQIMATLDPIDADAQRSLYASQLQAARSQVAGLEAQQKQAAAEASRLQA
FT                   LVGQQLVSRSQYDQAVAQRDSLRAQLDTAQRNVKVANDQLAIADLGVDNNIVRAPFSGV
FT                   VTAKAAQPGEIVSPLSAGGGFTRTGIGTIVDMESLEIEVEVGEAFIGRVQPKMPVEATL
FT                   NAYPEWKIPGEVIAIIPTADRGKATVKVRVALKVKDPRIVPEMGVRVSFLEQAQPQAAA
FT                   KPQGVRVPGGAVVQREGTSVAFVLGDESRVQQRTVEAGQAMGKDRQILKGVSAGESVVV
FT                   NPPDTLRDGAKVQQKQAQ"
     atgaacgctt ctgccgagct gttgaaggaa ctccgtatcg accgcaagtc cccgccgccc        60
     gcctcaggag ggagtggcag tggtggtggc cgccgctggc tgtggatcgc gatcatcgtg       120
     atcgtgttgc tgctggccgc tgctgccttc gccctgttcg ggcgtacccc ggcggtggac       180
     gtggaaaccg cgccggcagt ggccatccag cagggcaacg ccagcagttc ggtgctcgac       240
     gccagcggct atgtcgttgc gcggcgcatg gccaccgtct cggccaagat caccggcaag       300
     gttcgcgagg tgatgatcga ggaaggcatg cgcgtggagc agggccagat catggccacg       360
     ctggacccga tcgatgccga cgcgcagcgc agcctgtatg cctcgcagct gcaggccgca       420
     cgcagccagg tggccgggct ggaagcacag cagaagcagg ccgccgccga ggccagccgc       480
     ctgcaggcac tggtcggcca gcagctggtg tcgcgctcgc agtacgacca ggcggtggcc       540
     cagcgcgaca gcctgcgtgc acagctggac accgcacagc gcaacgtcaa ggtggccaac       600
     gaccagctgg ccatcgccga cctgggcgtg gacaacaaca tcgtgcgcgc gccgttctcc       660
     ggcgtggtca ccgccaaggc tgcgcagccc ggcgaaatcg tctcgccgct gtcggccggt       720
     ggtggcttca cccgtaccgg catcggcacc atcgtcgaca tggaatcgct ggagatcgaa       780
     gtcgaggtcg gcgaagcttt catcggccgc gtgcagccga agatgccggt ggaagccacg       840
     ctcaacgcct acccggaatg gaagattccg ggtgaggtga tcgccatcat ccccaccgcc       900
     gaccgcggca aggccacggt gaaggtacgc gtggcgctga aggtgaagga cccgcgcatc       960
     gtgccggaga tgggcgtgcg ggtcagcttc ctggaacagg cacagccgca ggcggccgcc      1020
     aagccgcaag gcgtgcgcgt gccaggtggc gccgtggtcc agcgcgaggg cacatcggtg      1080
     gccttcgtgc tgggtgacga gagccgcgtg cagcagcgca cggtcgaggc tggccaggcg      1140
     atgggcaagg accgccagat cctcaagggc gtgagcgcag gtgaatcggt ggtggtgaac      1200
     ccgccggaca ccctccgcga tggcgccaag gtgcaacaga aacaagcgca gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page