(data stored in ACNUC7421 zone)

EMBL: CP001111.PE255

CP001111.PE255       Location/Qualifiers
FT   CDS_pept        305251..306147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0255"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ccr:CC_1147 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49960"
FT                   /db_xref="GOA:B4STB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4STB7"
FT                   /protein_id="ACF49960.1"
FT                   /translation="MDPIAPSLARLQQVQVRYRDHTALHGIDLQVRAGQVLALLGRNGA
FT                   GKSTAISVLLGLRRADGGQVELLGGDPQQRTSRLGLGVMLQSTSLPPMLQVDELVAQAS
FT                   ACYPDPMPLQEVLQRAGLQALARRRYGQLSGGQQRAVQFAIALCGRPRVLFLDEPTTGL
FT                   DIQARRVMWQAIRQLVAEGCGVLLTTHYLEEAEALAQQVVVLEQGRVLADAPLSELRLA
FT                   DRPRRIRCRSGLPMEDVQQWPGVQEVQRDGEHLQLLASPAEPVVARLLAADAQLRELEV
FT                   QGAALADAFLDMTREAA"
     atggatccga tcgccccgtc gctggcccgc ctgcagcagg tgcaggtgcg ttaccgcgac        60
     cataccgccc tgcatggcat cgacctgcag gtccgcgctg gccaggtgct ggcgctgctg       120
     ggccgcaacg gtgccggcaa gagtaccgcg atcagcgtgt tgttgggcct gcgccgcgcc       180
     gatggcgggc aggtcgaact gctcggcggc gacccgcagc agcggaccag ccgtctcggc       240
     ctgggcgtga tgctgcagag caccagcctg ccgccgatgc tgcaggtgga cgaactggtg       300
     gcgcaggcaa gcgcctgcta ccccgacccg atgccgctgc aggaggtact gcagcgcgcc       360
     ggcctgcagg cgctcgcgcg ccgccgctac ggccagctgt ccggtggcca gcagcgcgcc       420
     gtgcagttcg ccatcgcgct gtgtgggcgg ccacgcgtac tgttcctgga cgagcccacc       480
     accggtctgg acatccaggc acggcgggtg atgtggcagg cgatccggca gctggtggcc       540
     gaaggctgtg gcgtgctgct gaccacccat tacctggagg aagccgaagc gctggcgcag       600
     caggtggtgg tgctggagca gggccgggta ctggccgacg cgccgctgag cgagctgcgc       660
     ctggccgatc ggccgcgccg catccgctgc cgcagcgggt tgcccatgga ggacgtgcag       720
     cagtggccgg gcgtgcagga ggtgcagcgc gacggcgagc acctgcagct gctggcgagc       780
     ccggccgagc cggtggtggc gcgcctgctg gccgccgacg cgcagctgcg cgagctggaa       840
     gtacagggcg cggcgctggc cgacgccttc ctcgacatga cccgggaggc cgcatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page