(data stored in ACNUC7421 zone)

EMBL: CP001111.PE26

CP001111.PE26        Location/Qualifiers
FT   CDS_pept        31048..33525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0026"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA ligase D,
FT                   3'-phosphoesterase domain protein; DNA polymerase LigD,
FT                   polymerase domain protein; DNA polymerase LigD, ligase
FT                   domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase; KEGG: xcb:XC_1808 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49731"
FT                   /db_xref="GOA:B4SR30"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR30"
FT                   /protein_id="ACF49731.1"
FT                   /translation="MSLHQYRRKRRLGGGAGQTPEPDDTPARGDPKRRPTFVIQLHHAS
FT                   SRHYDFRLEMDGVLKSWAVPKGPSLRVGEKRLAVEVEDHPLSYAGFEGDIPEGHYGAGH
FT                   VDVFDHGTWACEGDPLQALAAGKIDFVLHGQRLAGGWKLVRTAMKGRQVQWLLIKRDDG
FT                   EARDAEADDLLTAPMPKRAPAAKKRSVERAAAAARTTTRKADARWHARALKLDGARDTP
FT                   YPRAFKPQLTDHRDSAPDGARWLHEIKWDGYRLLADLHDGEVKLRSRNGLDWTDDFPEL
FT                   VQAVLALPVRDARLDGELVVLDPDGRSDFAALQRVIDGSSKQPLRYIVFDLPGVAGVDI
FT                   SRVPLLERKALLKDLIGPAPGTLAFSEHVIDHGPQVFDASGGAGFEGIVSKQVDAPYVN
FT                   TRARSWVKVKHEDTDEFVIVGHTAPKGSRVGFGSLLLATPDKAGLRYVGRVGTGFDDDS
FT                   LRALLKALQPLAVNAPVLQLPAHVPFRAASVRWVKPVTVAEVAFRGWGKEGLLRQASFK
FT                   RLRSDKQKEDLGMSTADTEAGGEVQITHPERVVFPKEKLSKGDVADYYQRVARWILPEL
FT                   AGRPLSLLRCPDGVGRACFFQKHHGPGLGDAVHAVPLQQKSGREDYVYIDDARGLLQLV
FT                   QMNTLELHPWGATVIDPEHPDRLVFDLDPGEGVSWAQVKAGARDVRDRLQQVGLKSFVR
FT                   LSGGKGVHVVVPMQPKAGWDEAKAFCEAFAQAMALEQPDRYVATMSKAKRNGVIFIDWL
FT                   RNTRGATSVCSWSLRARDGAGVAVPLRWEELARVSAADAFPMAKALARAKRLKGDPWQG
FT                   IERLKQTLPSLKR"
     atgtcgctgc accagtaccg gcgcaagcgc agactgggtg gtggcgccgg acagacgccg        60
     gagcctgacg acacgcccgc acgcggcgat ccgaagcggc ggccgacctt cgtcatccag       120
     ctgcatcacg caagctcgcg tcactatgac ttccgcctgg aaatggacgg cgtactgaag       180
     agctgggccg tgcccaaggg accttcgctg cgcgtcggtg agaagcggct ggccgtggag       240
     gtggaagatc acccgttgtc ctacgccggt ttcgaaggag acattcctga aggccactat       300
     ggcgctggcc acgtggatgt cttcgatcac ggcacctggg cctgtgaagg tgatccactg       360
     caggcgctgg cggctggaaa gatcgacttc gtgctgcacg ggcaacgcct ggccggtggc       420
     tggaagctgg tgcgtacggc aatgaaaggg cgtcaggtgc agtggctgct gatcaagcgc       480
     gacgatggcg aagcgcgcga cgccgaggcg gatgacctgc tgacggcacc gatgccgaaa       540
     cgagcgcctg cggcgaagaa gcgttccgta gagcgtgctg cagctgccgc acgcacgacc       600
     acacgcaagg ctgatgcgcg ctggcatgcg cgcgcgctga aactggacgg tgcacgcgat       660
     acgccctatc cacgcgcgtt caaaccgcag ttgaccgatc atcgcgacag cgcgccggac       720
     ggcgcgcgct ggctgcacga gatcaagtgg gatggttatc gcctgctggc cgatctgcac       780
     gatggcgagg tgaagctccg ctcccgcaac ggcctggatt ggactgatga ttttcccgag       840
     ctggtacagg ccgtgctggc actgccggtg cgtgatgcgc ggcttgacgg cgaactggtg       900
     gtgctggatc cggatggacg cagcgacttc gcagcgctgc agcgggtgat cgacggtagt       960
     tcgaagcaac cgctgcgcta catcgtgttc gatcttccgg gggtggccgg cgtggacatc      1020
     agtcgtgtgc cgttgctgga acgcaaggcg ctgctgaagg atctgatcgg gccggcgccc      1080
     ggcactctgg ccttcagcga acacgtgatc gaccatggac cgcaggtgtt cgacgccagc      1140
     ggtggggccg gcttcgaagg catcgtcagc aagcaggtgg atgcgccgta tgtgaacacc      1200
     cgcgcgcgca gctgggtcaa agtgaagcac gaagacaccg acgagttcgt gattgtcggc      1260
     cacacggcac ccaagggttc ccgggtggga tttggttcgc tgcttctggc cacgccggac      1320
     aaggctggcc tgcgctatgt gggccgcgtt ggcaccggct tcgacgacga tagcctgcgc      1380
     gcgctgctca aggcactgca gccgttggca gtgaatgcac cggtgctgca gctgccagcg      1440
     catgtgccgt tccgtgccgc cagcgtgcgc tgggtgaaac cggtgacggt ggcggaggtg      1500
     gcattccgtg gctggggcaa ggaaggcctg ctgcgccagg ccagtttcaa gcggctgcgc      1560
     agcgacaagc agaaagagga tctgggtatg agcacagccg ataccgaagc cggaggcgag      1620
     gtccagatca ctcatccaga gcgggtggtg tttccaaagg agaagctgag caagggcgac      1680
     gtggccgact actaccagcg cgtggcgcgt tggatcctgc ccgaacttgc cggacgtccg      1740
     ctgtcactgc tccggtgccc ggacggcgtg ggcagggcct gcttcttcca gaagcaccac      1800
     ggtcccggcc tgggcgatgc cgtgcacgcg gttccgctgc aacagaagag cggccgcgag      1860
     gattatgtct atatcgacga tgcacggggc ctgttgcagc tggtgcagat gaacaccctg      1920
     gagctgcatc cttggggcgc gaccgtgatc gatccagagc atccggatcg cctggtgttc      1980
     gatctcgatc ccggcgaagg cgtcagctgg gcacaggtga aagccggtgc acgcgatgtg      2040
     cgtgaccgcc tgcagcaggt gggcctgaag agcttcgtac gcctgtccgg tggtaagggc      2100
     gtgcacgtgg tggtgccgat gcagcccaag gcaggctggg acgaggcgaa ggcgttctgc      2160
     gaggcgttcg cgcaggcaat ggcgctggag cagcctgatc gctacgtggc gacgatgagc      2220
     aaggcaaagc gcaatggcgt catcttcatc gactggctgc gcaatacgcg gggggccacc      2280
     agcgtctgtt cgtggtcgct gcgcgcgcgc gatggtgcgg gcgtggcggt gccgctgcgc      2340
     tgggaagagc tggcccgggt gagcgcggct gacgcgtttc cgatggccaa ggcgctggcg      2400
     cgtgccaagc ggctgaaggg tgacccatgg cagggcattg aacggttgaa gcagacgctg      2460
     ccgtcgctga agcggtag                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page