(data stored in ACNUC7421 zone)

EMBL: CP001111.PE260

CP001111.PE260       Location/Qualifiers
FT   CDS_pept        complement(309882..310985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0260"
FT                   /product="Catalase domain protein"
FT                   /note="PFAM: Catalase domain protein; KEGG: xac:XAC3990
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49965"
FT                   /db_xref="GOA:B4STC2"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC2"
FT                   /protein_id="ACF49965.1"
FT                   /translation="MSLFRYTRAGQTPGAPRKHSPLLWIALIALILGAVALAFAWLAGW
FT                   IGGRLTAQRFTDTIEATGPAHPGFRRAHSKGICVSGWFEPSSQAPTLSSARVFSQQKVP
FT                   VMGRLSIGGGDPYGADNTARVRSLAVQMVSDDGQEWRMAMNSFPFFAAPNAEAFYEQTR
FT                   ASIPDPATGKPDPQKMAAVLAKYPSAQAFQQWAKTAPWTSSWADTTFNSVNSFWFTNVQ
FT                   GQKRAVRWRWQPQAPVVEMDADTRKKASVDFLSQELQQRLASGPVRWNLVVTTAEPGDA
FT                   IDDPSVPWPESREQVVAGVLSLDRLQSQEQGACGQINFDPLILPSGVRGSDDPILAARS
FT                   AVYSQSFNRRERERASGNVEQPKEAAR"
     atgtcgctct tccgctacac ccgcgctggc cagacgccgg gcgcaccgcg caagcattcc        60
     cccctgctct ggatcgcact gatcgcactc attctgggtg cggtggcgct ggccttcgcc       120
     tggttggccg gctggattgg cggccgcctg accgcgcagc gcttcaccga caccatcgaa       180
     gccaccggcc ctgcccatcc cggcttccgc cgtgcgcaca gcaagggcat ctgcgtgagc       240
     ggctggttcg aacccagttc gcaggcgccg acgctgtcca gtgcacgggt gttttcacag       300
     cagaaggtgc ccgtgatggg ccgcctgtcg atcggcggtg gcgaccccta cggcgccgac       360
     aacaccgcgc gcgtgcgcag cctcgctgtg cagatggtca gcgacgacgg ccaggaatgg       420
     cggatggcga tgaacagctt cccgttcttc gctgccccca acgccgaggc gttctacgag       480
     cagacgcgcg cctccattcc cgacccggcc accggcaagc ccgacccgca gaagatggcc       540
     gcggtgctgg cgaagtaccc gagtgcgcag gcgttccagc aatgggccaa gacagcgccg       600
     tggaccagca gctgggccga caccaccttc aacagcgtca acagcttctg gttcaccaat       660
     gtgcagggcc agaagcgcgc ggtgcgctgg cgctggcagc cgcaggcgcc ggtggtggag       720
     atggacgcgg acacgcgcaa gaaggccagt gtcgatttcc tcagccagga actgcagcag       780
     cgcctggcca gtggcccggt gcgctggaac ctggtcgtca ccaccgccga acccggcgat       840
     gccatcgatg atccttcagt gccgtggccc gaatcgcgtg aacaggtggt ggccggcgtg       900
     ctcagcctgg accgcctgca gtcgcaggaa cagggcgcct gcggccagat caacttcgat       960
     ccgctgatcc tgcccagtgg cgtgcgtggc agtgacgatc cgatcctggc cgcccgctcg      1020
     gccgtgtact cgcaatcctt caaccgacgc gaacgcgagc gcgccagcgg caacgtggag      1080
     caaccgaagg aggccgcacg atga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page