(data stored in ACNUC7421 zone)

EMBL: CP001111.PE262

CP001111.PE262       Location/Qualifiers
FT   CDS_pept        complement(312492..313211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0262"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: xcb:XC_3991 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49967"
FT                   /db_xref="GOA:B4STC4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC4"
FT                   /protein_id="ACF49967.1"
FT                   /translation="MKFPVLAITLDLDDTLWPFAPIGARIDLVLHEWMREHSPATAAMY
FT                   PLAAMRELRERSFRDNPHLHHDLSALRRLTLQEALQNSGASLELLEPAYEAFYAARNQV
FT                   ECYPDAIDALARIAARVPVAALSNGNADLERIGLAHHFAFQLGAREHGAAKPEASIFHA
FT                   ACTRLGVAPAQVLHVGDHAEMDVAGAIAAGLRGCWINREAATWTHPQLQPDLQFDTLTG
FT                   LADWLDDNLDAAAPRST"
     gtgaaattcc ctgtccttgc catcaccctc gacctcgacg acacgctctg gccgttcgcc        60
     ccgatcggcg cccgcatcga cctggtcctg cacgagtgga tgcgtgaaca cagccctgcc       120
     actgccgcga tgtatccgct ggcggcgatg cgcgaactgc gcgagcgctc gttccgagac       180
     aatccacacc ttcaccatga cctgagcgcg ctgcgccggc tgacgctgca ggaggccctg       240
     cagaacagcg gcgccagcct ggaattgctc gaaccggcct acgaggcgtt ctacgccgcg       300
     cgcaaccagg tcgagtgcta tcccgacgcg atcgatgcgc tggcgcggat tgccgcgcgg       360
     gtcccggtgg cagcgctgag caacggcaat gccgatctgg agcggatcgg cctggcccat       420
     catttcgcct tccagctggg tgcgcgcgaa cacggcgcgg ccaagcccga ggcaagcatc       480
     ttccacgccg cctgcacccg cctgggtgtg gcgccggcac aggtgctgca tgtcggcgac       540
     cacgccgaga tggacgtggc cggggcgatc gccgccggcc tgcgcggctg ctggatcaac       600
     cgcgaagccg cgacctggac ccatccgcaa ttgcagccgg acctgcagtt cgacaccctc       660
     accggcctgg ccgactggtt ggatgacaac ctcgatgccg ccgcaccccg gagtacctga       720
//

If you have problems or comments...

PBIL Back to PBIL home page