(data stored in ACNUC7421 zone)

EMBL: CP001111.PE267

CP001111.PE267       Location/Qualifiers
FT   CDS_pept        complement(315830..317263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0267"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: xcv:XCV4074 protease DO precursor; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49972"
FT                   /db_xref="GOA:B4STC9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4STC9"
FT                   /protein_id="ACF49972.1"
FT                   /translation="MRPLPTLLTLAIAAAFGGFVATGLNAHLDNRADAAPLPAVLPTAA
FT                   ALPASVAGQAVPSLAPMLEKAMPAVVSVNTKQVVRVRNPFFNDPFFRRLFPDIPQERIN
FT                   ESLGSGVIIDAKEGLVLTNHHVIDNADDVQVTLADGRTVKAEFLGSDRDTDIALIRIPA
FT                   QNLTDIKLGNSDQLRVGDFVVAIGNPFGFSQTVTSGIVSAVGRSGIRGLGYQNFIQTDA
FT                   SINPGNSGGALVDLQGQLVGINTASFNPQGSMAGNIGLGLAIPSNLARSVVDQLVKHGV
FT                   VVRGTLGVESQNLTAQIAQGLGLGETRGALVTRVLAGSAAAAAGLKPGDVVVSANGQRV
FT                   DSAEALHNVEGLATVGSPLTLDVRREGKPLQIKAILKEQARAVTGDSLDPRLGGATFVD
FT                   LPESLRQSGAGGVLVSEVKRGSRAASNGLQQGDIITDATVGEFADLASWRANFQQRPPT
FT                   LVLRVLRNNGQQQGQLVMR"
     atgcgaccgc ttcccaccct gctcacgctc gcaatcgccg ccgccttcgg tggctttgtt        60
     gccaccggcc tcaatgcgca cctggacaac cgtgccgatg ccgcgccgct gccggcggtg       120
     ctgcccaccg ccgccgcgtt gccagcttcg gtagccgggc aggcggtgcc gtcactggcg       180
     ccgatgctgg agaaggcgat gccggcagtg gtcagcgtca acaccaagca ggtggtgcgg       240
     gtgcgcaacc ccttcttcaa cgacccgttc ttccgccgcc tgttcccgga catcccgcag       300
     gagcgcatca acgaatcgct cggctcgggc gtgatcatcg atgccaagga aggcctggta       360
     ctgaccaacc accatgtcat cgacaatgcc gatgacgtgc aggtgacact ggccgacggg       420
     cgcacggtca aggccgagtt cctcggctcg gaccgcgata cggacatcgc gttgatccgc       480
     attccggcgc agaacctgac cgacatcaag cttggcaaca gcgaccagct gcgcgtgggc       540
     gacttcgtgg tggccatcgg caacccgttc ggtttcagcc agacggtcac ctccggcatc       600
     gtctcggcgg tgggccgcag cggcatccgc gggctgggct accagaactt catccagacc       660
     gatgcgtcga tcaacccggg caattccggt ggcgcactgg tcgacctgca gggccagctg       720
     gttggcatca acaccgccag tttcaacccg cagggcagca tggccggcaa catcggcctg       780
     ggcctggcga tcccctccaa cctggcgcgc agcgtggtcg accagcttgt caagcacggc       840
     gtggtggtgc gcggcacgct gggcgtggag agccagaacc tgaccgcaca gatcgcgcag       900
     ggcctgggcc tgggcgaaac ccgcggcgca ctggtcaccc gcgtgctggc cggatcggct       960
     gcggccgctg cgggcctgaa accgggcgat gtggtggtgt cggccaacgg ccagcgcgtg      1020
     gacagcgccg aagcgctgca caacgtggaa ggcctggcca cagtgggcag cccgctgacg      1080
     ctggacgtgc gtcgcgaagg caagccgctg cagatcaagg cgatattgaa ggaacaggca      1140
     cgcgcggtca ccggcgacag cctggacccg cgcctgggcg gtgccacctt cgtcgatctg      1200
     cccgaatcgc tgcgccagtc cggcgctggc ggcgtcctgg tcagcgaggt caagcgcggc      1260
     agccgcgccg ccagcaacgg gctgcagcag ggcgacatca tcactgatgc aacagtaggt      1320
     gaattcgctg acctggccag ctggcgcgcc aatttccagc agcgcccacc caccctggtg      1380
     ctgcgcgtgc tgcgtaacaa tggccagcag cagggccagc tcgtgatgcg ctga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page