(data stored in ACNUC7421 zone)

EMBL: CP001111.PE269

CP001111.PE269       Location/Qualifiers
FT   CDS_pept        318771..319460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49974"
FT                   /db_xref="GOA:B4STD1"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD1"
FT                   /protein_id="ACF49974.1"
FT                   /translation="MRGIDFSSWQGVLSTLAGLVLITLLGVGIRLLVMQTLQQRREREN
FT                   RQINERLRTLMAAYKTLGGSFTGELGVDPSHRRDLRQRQDAEGIAEPRSDRARRIRDAV
FT                   EAALSDILLLGTDEQVRLAARAANELAQGRPVHTHDLVVSLRDFVREALDLAPIPADLQ
FT                   IPPQGPTRPGGASGKGRAEGDAKGGRTGGGGGGGGGMGAGMGGVGLGAGAALGAGHASA
FT                   SDEVDAR"
     atgcgcggta tcgacttcag ttcctggcag ggcgtgctgt ccacgttggc cggcctggtc        60
     ctgatcaccc tgctgggcgt gggcatccgc ctgctggtga tgcagaccct gcagcagcgc       120
     cgcgagcgcg agaaccggca gatcaatgag cggctgcgca cgctgatggc ggcctacaag       180
     accctgggcg ggtcgttcac tggcgaactg ggtgtggatc ccagccatcg ccgcgacctg       240
     cgccaacgcc aagatgccga aggcatcgcc gaaccccgct cggatcgcgc gcgccgcatc       300
     cgcgacgccg ttgaagcggc gctgtcggac atcctgttgc tgggcaccga cgaacaggta       360
     cggctggccg cgcgtgcggc caacgaactg gcgcagggac gaccggtgca cacccacgat       420
     ctggtggttt cactgcgcga tttcgtgcgc gaagcgctgg acctggcgcc gatcccggcc       480
     gatctgcaga ttccaccgca gggcccgacc cgcccgggcg gtgccagtgg caagggccgc       540
     gccgagggtg acgccaaggg gggccgcact ggaggcggcg gtggtggcgg gggcgggatg       600
     ggcgccggca tggggggcgt gggtcttggc gccggcgccg cactgggcgc cggccatgcc       660
     tctgccagcg atgaagtgga cgcgcgctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page