(data stored in ACNUC7421 zone)

EMBL: CP001111.PE27

CP001111.PE27        Location/Qualifiers
FT   CDS_pept        complement(33597..33989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49732"
FT                   /db_xref="GOA:B4SR31"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR31"
FT                   /protein_id="ACF49732.1"
FT                   /translation="MPGLLKTLFLSIVALIGGVLSLALVSSVASWLPPLVGLSPGDSSV
FT                   QLGWDLAFSVLGGVAGISFATYYAPCWPRSHGFSIWSLIALGCGYAVWTAGADFPLWFV
FT                   ISLLASLPLQLLAGWWFGRRASRDPR"
     atgcccggcc tgctcaaaac cctgttcctg tccatcgtcg ccctgatcgg cggcgtgctg        60
     tcgcttgcgc tggtcagcag cgtcgccagc tggctgcccc cgctggtggg cctgtcgccg       120
     ggcgatagca gcgtgcaact ggggtgggac ctggccttca gcgtgctcgg cggcgtcgcc       180
     ggcatttcct tcgccaccta ctacgcgccg tgctggccgc gttcgcatgg tttttcgatc       240
     tggtcgctga tcgcgctggg ctgtggttac gcagtgtgga cggccggtgc ggatttcccg       300
     ttgtggttcg tcatttcgct gctggcgtca ctgccgctgc agctgctggc cggctggtgg       360
     ttcggtcgcc gcgcgtcgcg cgatccgcgc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page