(data stored in ACNUC7421 zone)

EMBL: CP001111.PE273

CP001111.PE273       Location/Qualifiers
FT   CDS_pept        complement(321560..321949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49978"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD5"
FT                   /protein_id="ACF49978.1"
FT                   /translation="MDAILTPVSIGELIDKITILEIKAERIDDAAKLSNVRTELDGLLP
FT                   LLQLQLQAQPALAMLKQQLKAINERMWDIQDQLRDKEAAQVFDDAFIQLARGVYGTNGE
FT                   RVQVKNEINRVAGSALVEEKQYQGE"
     gtggacgcca tcctgactcc ggtatcgatc ggcgagctga tcgacaagat caccattctc        60
     gagatcaagg ccgagcgcat cgacgatgcc gccaagctga gcaacgtgcg caccgagctg       120
     gacggcctgc ttccgttgct gcagctgcag ctgcaggctc agccggcgct ggccatgctg       180
     aagcagcagc tgaaggcgat caacgagcgc atgtgggaca tccaggacca gctgcgcgac       240
     aaggaagcgg cccaggtgtt cgacgatgcc ttcatccagt tggcgcgtgg tgtctatggc       300
     accaatggcg agcgcgtgca ggtgaagaac gagatcaacc gcgtggccgg ttcagcgctg       360
     gtggaagaga agcagtacca gggcgagtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page