(data stored in ACNUC7421 zone)

EMBL: CP001111.PE278

CP001111.PE278       Location/Qualifiers
FT   CDS_pept        325601..326353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0278"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: xcv:XCV4032 putative oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49983"
FT                   /db_xref="GOA:B4STE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE0"
FT                   /protein_id="ACF49983.1"
FT                   /translation="MTRTVLITGATSGFGAAAVHRFAQAGWKVIATGRRGERLQPLVER
FT                   YGKDVVHAAVFDIRDPVAMEAALLALPPAFGEIDLLVNNAGLAQGTAPAQSAKLSDWTT
FT                   MIDTNITALVTLTHRLLPQLVERKGAIINISSVAGVYPYPGGNAYGGTKAFVSQFSLGL
FT                   RSDLHGTGVRVTTIEPGMAETEFTVVRTHGDQAASDKLYTGANPMTAEDIAEQIFWVAT
FT                   LPPHLNINRLELMPVSQSFAGFQVAREG"
     atgacccgca ctgtcctgat taccggcgcc acttccggct tcggcgccgc tgccgtccac        60
     cgcttcgccc aggcgggctg gaaggtgatc gccaccggcc gccgcggcga acgcctgcag       120
     ccgctggtcg aacgctatgg caaggacgtg gtgcatgccg cggtcttcga catccgcgac       180
     ccggtggcga tggaagcggc gctgctggcg ctgccgccgg cgttcggtga gatcgacctg       240
     ctggtcaaca acgctggcct ggcacagggc accgcgccgg cacagagcgc aaagctgtcc       300
     gactggacca cgatgatcga caccaacatc accgcactgg tgaccctgac ccaccgcctg       360
     ctgccgcaac tggtcgagcg caagggcgcg atcatcaaca tttcctcggt ggccggcgtc       420
     tacccctacc cgggcggcaa cgcctacggt ggcaccaagg ccttcgtcag ccagttctcg       480
     ctgggcctgc gctcggatct gcacggtacc ggcgtgcgcg tgaccacgat cgagccgggc       540
     atggccgaaa ccgagttcac cgtggtgcga acccatggcg accaggctgc gtcggacaag       600
     ctctataccg gcgccaaccc gatgaccgcc gaagacatcg ccgaacagat cttctgggtg       660
     gccacgctgc cgccgcacct caacatcaac cgcctggagc tgatgccggt cagccagtcg       720
     ttcgcaggtt tccaggtcgc ccgcgaaggc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page