(data stored in ACNUC7421 zone)

EMBL: CP001111.PE281

CP001111.PE281       Location/Qualifiers
FT   CDS_pept        complement(329251..329955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0281"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: xcv:XCV4028 DNA
FT                   repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49986"
FT                   /db_xref="GOA:B4STE3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4STE3"
FT                   /protein_id="ACF49986.1"
FT                   /translation="MPIHDWPEQERPREKLMARGPTALSDAELLALFLGSGFGGRDAVQ
FT                   TARDLLQAHGPLRVLLDRPARELARLPGLGPARSCTLAAGLELAHRYLAAELEHGEAVG
FT                   NNPAAVGRYLQHRLRGQAREIFMALFLDNRHRLIACEELFHGTINAAPVYPREVVRRAL
FT                   LHNAAAVILSHNHPSGDPEPSSADTRITDELQQALAMVDVRLLDHFVVGEGRPVSFAER
FT                   GLLSPPQPRLFG"
     atgcccatcc acgactggcc cgaacaggaa cgtccccgcg aaaagctgat ggcacgcggg        60
     cccacggcgc tttccgatgc cgaactgctg gcgctgttcc tgggctccgg tttcggcggc       120
     cgcgatgccg tgcagaccgc gcgcgacctg ctgcaggcgc acggcccgtt gcgggtgctg       180
     ctggaccgcc ccgcgcgtga actggcccgc ctgcccgggc tcggcccggc gcgcagctgt       240
     acgctggctg ccgggctgga actggcccac cgctacctgg ctgccgagct ggaacatggc       300
     gaggcggtcg gcaacaatcc ggccgcggtc ggccgctacc tgcagcaccg cctgcgcggc       360
     caggcccggg agatcttcat ggccctgttc ctggacaacc gccaccggct gatcgcctgc       420
     gaggagttgt tccacggcac catcaacgcc gcgccggtct acccccgcga agtggtgcgg       480
     cgcgccctgc tgcacaacgc ggcggcggtg atcctcagcc acaaccaccc ttccggcgac       540
     ccggaaccct ccagcgccga tacccgcatc accgacgaac tgcagcaggc actggcgatg       600
     gtggacgtgc gcctgctgga ccacttcgtg gtcggtgagg gccgccccgt ttcgtttgct       660
     gaacgaggcc tgctgtcgcc gccccagccc cggctgttcg gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page