(data stored in ACNUC7421 zone)

EMBL: CP001111.PE282

CP001111.PE282       Location/Qualifiers
FT   CDS_pept        330107..331162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_C_1421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49987"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE4"
FT                   /protein_id="ACF49987.1"
FT                   /translation="MKRLSLILILSTSILPGPAGAGGAAATYEELSSLANSGAAVVAAS
FT                   FDGAVLAGTGRRGCCFSQAFRWSSQDGVRWLSRQHEAEDSSARAISRDGQIILVETRIS
FT                   TAMQVLRWLPDGERVAVTPVSQSHRGLAMNADGTVVGGAEYLYHSPDSEQPYLWSEAEG
FT                   YRILPAPGGADGTRPTHFDPDPAVVHGIFFVDGPEPGNPARPMRIRWRNDEIDPASLAP
FT                   MPDDTLQIGQIAMEQSLQVAGIDRYEPMSIVWMDLQGGILLGSEPFSNQALIWTRSNGV
FT                   CRLEDWLRALPVELPEETRWEGSLVSPDGRVLVGVGHRKEGEEQVPWRVSSEVPLADIV
FT                   LSAPGCAASAS"
     atgaagcgac tttccctgat cctgatcctt tcaacgtcga tactgcctgg tccggccggg        60
     gcagggggcg ctgccgccac ctacgaggaa ctgtcctcgt tggccaacag cggagctgcg       120
     gtcgtggcgg caagcttcga tggcgctgta ctggcgggga ctggccgtcg cggatgctgc       180
     ttctcgcagg cattccgatg gtccagccag gatggtgtcc gctggctgtc acggcagcac       240
     gaagcagaag acagttcggc tcgggcaatc agcagggacg gtcagatcat cctggtggag       300
     acccgaatct cgaccgcgat gcaggttctc cgctggttgc ctgatggcga acgggttgcg       360
     gttaccccgg tcagccaatc ccaccgaggc ttggcgatga acgctgatgg gacagtcgtc       420
     gggggggcgg agtacctcta ccactcaccg gatagcgagc agccgtacct gtggagcgag       480
     gcagaaggct atcgcattct tccggcacca ggaggagccg acggtacgcg tcccacccat       540
     ttcgacccgg atccggctgt tgtccatggc attttctttg tcgacgggcc tgaaccaggc       600
     aatcccgcga ggcccatgcg gatccggtgg cgaaacgatg aaatcgatcc cgcctcgctt       660
     gcacccatgc cggatgacac cctccagatc ggtcagatcg ccatggagca gtcgcttcag       720
     gtcgcaggga tcgatcgcta cgagccaatg tcgatcgtgt ggatggatct gcagggcgga       780
     atcctgctgg gaagcgagcc attttccaac caggcactga tctggacgcg cagcaacggc       840
     gtgtgtcgtc tggaagactg gctgcgggca cttcctgtgg agctccccga agagacccgt       900
     tgggaaggct ctctggtcag cccggacgga cgcgtgctgg ttggcgttgg gcaccgcaag       960
     gaaggcgagg agcaggttcc ctggcgggta tcgtcggagg tgcctttggc agacattgtc      1020
     ctttctgctc ctggttgcgc cgcttcagcc agctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page