(data stored in ACNUC7421 zone)

EMBL: CP001111.PE283

CP001111.PE283       Location/Qualifiers
FT   CDS_pept        complement(331174..331800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0283"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bcm:Bcenmc03_4702 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49988"
FT                   /db_xref="GOA:B4STE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE5"
FT                   /protein_id="ACF49988.1"
FT                   /translation="MHPRIIIADDHPVVLHGIRVVLQTHLMDVVGSACDGAELLQLVDN
FT                   NDCDAVLTDLSMPGAGPDGPELIDALRARHPGLPVVVLTGARHPGLLDGLLREGISGLV
FT                   DKCADFTELPQALSAALAGQVFVSQQLRHHLQARDLLFPREPAPLSAREQEVLDLLAAG
FT                   LSVNAVAERCGRSPKTISRQKAEAKRKLGLQNNQELFDYLQTRRD"
     gtgcacccac gcatcatcat cgccgacgac catcctgtgg tcctgcacgg catccgcgtc        60
     gtgctgcaga cccacctgat ggacgtggtc ggcagtgcgt gcgatggcgc cgagctgctt       120
     cagctggtgg acaacaacga ctgcgatgca gtgctgaccg atctgtcgat gcccggcgcc       180
     gggccggatg gtccggaact gatcgacgcg ctgcgcgcac gtcatccggg gctgccggtg       240
     gtggtgttga ccggtgcgcg ccatcccggg ctgcttgacg gcctgctgcg cgaaggcatc       300
     agcggcctgg tcgacaagtg cgccgatttc accgaactgc cgcaggcctt gagcgcggca       360
     ctggccggcc aggtgttcgt ttcccagcag ctgcgccacc acctgcaggc ccgcgacctg       420
     ctgttcccgc gcgaaccggc accgctgtcg gcacgcgagc aggaggtgct ggatctgctg       480
     gcggccgggc tcagcgtgaa cgctgtcgcc gagcgctgcg ggcgcagtcc gaagaccatc       540
     agccggcaga aggccgaagc caagcgcaag ctgggcctgc agaacaacca ggaactgttc       600
     gactatctgc agacccggcg cgattga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page