(data stored in ACNUC7421 zone)

EMBL: CP001111.PE284

CP001111.PE284       Location/Qualifiers
FT   CDS_pept        332029..333291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0284"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: xcb:XC_3943 bifunctional
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49989"
FT                   /db_xref="GOA:B4STE6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE6"
FT                   /protein_id="ACF49989.1"
FT                   /translation="MADSPNASPAPARALEGQKLLLCVGGGIAAYKALELVRRLRDAGA
FT                   QVQVAMTAGAQQFVTPLSFQALSGQPTRTTLWDSAAEQAMGHIELARWADRIVVAPGTA
FT                   DLLARLAQGHADDLVSTLCLASTAPLTICPAMNHRMWLHPATQANIALLRQRGAQVIGP
FT                   VDGPLAEGESGPGRLAEPGDIVAALAANGSAEAPAAAPETRALQGLRLLISAGPTYEDI
FT                   DPVRYVGNRSSGKMGFALAAAAAALGAQVVLVSGPVQLPTPQGVQRIDVRSAAQMRDAV
FT                   LKSLPADIYIGAAAVSDYTPRQVAPQKLKKTADSQSLVIELVRTPDILAEVAAQTQSLK
FT                   LVVGFAAETHDVEKYARGKLVDKRLDLVIANQVGISGGGFESDNNAATAFWQDGEQVFP
FT                   ATSKRELAEQLLALIARRLQA"
     gtggctgact cccccaatgc ttctcccgcg ccggcccgcg cgctggaagg tcagaaactg        60
     ctgttgtgcg tcggaggcgg gatcgcggcc tacaaggctt tggagctggt gcggcgcctg       120
     cgcgacgctg gcgcccaggt gcaggtggcg atgaccgccg gtgcccagca gttcgtcact       180
     ccgctcagtt tccaggccct gtccgggcag ccaacccgca ccacgctgtg ggacagtgcc       240
     gccgaacaag ccatgggcca catcgagctg gcccgctggg ccgaccgcat cgtggtcgcc       300
     cccggcaccg ccgatctgct ggcgcggctg gcccagggcc atgccgatga cctggtcagc       360
     accctgtgcc tggccagcac cgcgccgctg acgatctgcc cggcgatgaa ccatcgcatg       420
     tggctgcacc cggccaccca ggccaatatc gccctgctgc gccaacgtgg cgcacaggtg       480
     atcggcccgg ttgacggtcc gctggccgaa ggcgaatccg gtcctggccg tctggccgaa       540
     ccgggtgaca tcgtcgccgc gctggccgcc aacggcagtg ccgaggcacc ggctgccgcg       600
     ccggaaaccc gcgcgctgca gggcctgcgc ctgctgatca gcgccggccc cacctatgaa       660
     gacattgacc cggtgcgtta cgtcggcaac cgcagcagcg gcaagatggg ctttgccctg       720
     gccgctgcgg cggccgcact cggcgcccag gtggtactgg tcagtggccc ggtgcagctg       780
     ccgacgccgc agggcgtgca gcgcatcgac gtgcgctcgg ccgcgcagat gcgcgatgcc       840
     gtgctgaagt cgctgccggc cgacatctat atcggtgcgg cggccgtttc cgactacacg       900
     ccgcgccagg tcgcgccgca gaagctgaag aagaccgccg acagccagtc actggtgatc       960
     gagctggtgc gcacgccgga catccttgcc gaggtggccg cacagacgca gtcgctgaag      1020
     ctggtggtcg gctttgccgc cgagacccac gacgtggaga aatatgcgcg gggcaagctg      1080
     gtcgacaagc gcctggacct ggtgatcgcc aatcaggtcg gcatcagcgg cggcggtttc      1140
     gagagcgaca acaatgccgc cactgccttc tggcaggatg gtgaacaggt attcccggcc      1200
     acctccaagc gcgagctggc cgaacaactg ctggcgctga tcgcgcggag acttcaggca      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page