(data stored in ACNUC7421 zone)

EMBL: CP001111.PE287

CP001111.PE287       Location/Qualifiers
FT   CDS_pept        complement(336218..336931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0287"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: xac:XAC0760 two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49992"
FT                   /db_xref="GOA:B4STE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE9"
FT                   /protein_id="ACF49992.1"
FT                   /translation="MSPTPIDASVPAARVLVIDDETQIRRFLDISLRAQGYQVRQAATG
FT                   QEGLQLAASEDMDLVILDIGLPDMEGHEVLEQLRQWSQVPVIMLTVRAGETEKVRALDT
FT                   GANDYVTKPFGTQELMARVRALLRTRSVPSDGTPPVFDDGHLHVDLVRREVALDGEPVA
FT                   LTRKEYALLSLLLRNAGRVVTQPQILQEIWGPTHQHDTHYLRILVGKLRHKLGDSALDS
FT                   RYLFTEPGVGLRFKG"
     atgagtccga ccccgattga tgccagcgtc ccggccgcgc gcgtgctggt gatcgatgat        60
     gaaacccaga tccgccggtt cctggacatc agcctgcgcg cgcagggcta ccaggtacga       120
     caggccgcca ccggccagga aggcctgcag ctggccgcca gcgaggacat ggatctggtg       180
     atcctggata tcggcctgcc ggacatggaa ggccacgagg tactggaaca gcttcggcag       240
     tggagccagg tgccggtgat catgctgacc gtgcgtgccg gcgaaaccga gaaggtgcgc       300
     gcgctggata caggcgcgaa cgactacgtg accaagccgt tcggcacgca ggagctgatg       360
     gcgcgggtgc gggcgctgct gcgcacgcgc agcgtgccca gtgatggcac gccgccggta       420
     ttcgacgatg gccacctgca tgtggacctg gtgcgtcgtg aagtggcgct ggatggcgag       480
     ccggtggcgc ttacccgcaa ggaatacgcg ttgctctcac tgctgctgcg caatgccggg       540
     cgagtggtga cccagccgca gatcctgcag gagatctggg gaccgaccca ccagcacgac       600
     actcattacc tgcgcatcct ggtcggcaag ctgcggcaca agctgggcga ttcagcgctg       660
     gattcgcgct acctgttcac cgaaccgggc gtgggtttgc ggttcaaggg gtag             714
//

If you have problems or comments...

PBIL Back to PBIL home page