(data stored in ACNUC7421 zone)

EMBL: CP001111.PE288

CP001111.PE288       Location/Qualifiers
FT   CDS_pept        complement(336912..339587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0288"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG: xcb:XC_3529
FT                   two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49993"
FT                   /db_xref="GOA:B4STF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF0"
FT                   /protein_id="ACF49993.1"
FT                   /translation="MTAAPMTDARTRQADALVEGLQREAGGKLTVFLGAAPGVGKTYTM
FT                   LTRAQEQLRRGVDLVVGLVETHGRADTQALLEGLPQLPLKEVAYHGHSLQEMDLDAVLA
FT                   RHPALVLVDELAHRNAPGSRHERRWQDVMELLDAGIDVWTTVNIQHLESLNDVVMRITG
FT                   VRVSETVPDGVLDRLHDIVLVDLPPRELIARLQQGKVYVPEQAAQALQAFFSPANLTAL
FT                   RELAMQEAADRVDSSLREARAARGESNLPLRRGVLVAIDGGGQSEYLVRVARRIAERRD
FT                   APWTVVTVQGRRQDEATRREIDAAFALARRLGGDAELLHGSSIADALLDHAAHNGVSTL
FT                   VLGRTRERPLARMFNRTLTQQLIQRGAHYEITIISTPQARARSRREGLLPPVRGISHEP
FT                   AQALIATALACAVAWLAERWVGMADLSMVFIVAVVVVAARTRASVAVMAAILCFLAYNF
FT                   LFIAPRFTFAIGARQGVITVFLFLAAALVAGRLASRLRMQVIALRAANRHARARQQLGR
FT                   QLASAAGNGEVAQAGRLALEQAMDVPAWLRIGTDTAAGGRSQPGDTDLAAADWALRHGQ
FT                   PSGRFTDTLAGAQWWFLPLLDGEDRAIGVAGLYLPGAQARLLPEQRQLAEAMVDDIAQA
FT                   ALRTRLVAELEQAHVSNETERLRSALLSSVSHDLRSPLAAMIGSADSLASYGAAMDTTD
FT                   RRALLDTILVEGERLDRYIQNLLDMTRLGHEGLKINRDWIGVDELIGSAARRLQRYQPK
FT                   VRLELDIPSSLAPIWVHPALVEQAVFNVMENAAKFSPPDAAVQVQARELDGQLRIDVID
FT                   AGPGIPDDERARIFDMFYSVERGDRGRHGTGLGLTICQGMIGAHGGSVQALPGRDGRGT
FT                   LIRITLPLLKPASHDESDPD"
     atgacagcgg cacccatgac tgatgcgcgt acccgccagg ccgatgccct ggtcgaaggc        60
     ctgcaacgcg aagccggcgg caagctgacc gtgttcctcg gtgcggcgcc gggcgtgggc       120
     aagacctaca cgatgctgac ccgcgcgcag gaacagctgc gccgcggtgt cgacctggtt       180
     gtgggcctgg tggaaaccca tggccgtgcc gatacccagg cactgctgga aggcctgccg       240
     cagttgccgc tgaaggaagt ggcctaccac ggccactcgc tgcaggagat ggatctggat       300
     gccgtgctcg cccggcatcc ggcgctggtg ctggtggacg aactggccca ccgcaatgcg       360
     ccgggcagcc gccacgagcg gcgctggcag gatgtgatgg agctgctgga cgccggcatc       420
     gacgtctgga ccacggtcaa catccagcat ctggaaagcc tcaacgatgt ggtgatgcgg       480
     atcaccggcg tgcgcgtcag cgagaccgtg ccggacggcg tgctcgaccg cctgcacgac       540
     atcgtgctgg tcgacctgcc gccgcgcgaa ctgatcgcgc gcctgcagca gggcaaggtc       600
     tatgtgcccg aacaggctgc gcaggcgctg caggcattct tctcgccagc caacctgacc       660
     gcgctgcgcg aactggcaat gcaggaagcg gccgaccgcg tcgatagcag cctgcgcgaa       720
     gcacgggcgg cacgcggcga gagcaacctg ccgctgcggc gtggcgtatt ggtggccatt       780
     gatggcggcg gccagagcga atacctggtg cgggtggcgc gacgcatcgc cgaacgccgc       840
     gacgcgccgt ggacggtggt gaccgtgcag ggccggcgcc aggacgaggc gacccggcgc       900
     gagatcgatg ccgcgttcgc gctggcacga cgactgggcg gcgacgccga gctgctgcat       960
     ggttcgagca ttgccgatgc cctgctcgac catgccgcac acaacggcgt atcgaccctg      1020
     gtcctgggcc gcacccgtga acggccgctg gcgcggatgt tcaaccgcac cctgacccag      1080
     cagctgatcc agcgcggcgc gcattacgag atcaccatca tcagcacgcc gcaggcgcgc      1140
     gcgcgttccc gccgcgaggg cctgctgcca ccggtgcgcg gtatcagcca tgagccagcg      1200
     caggcgctga tcgccaccgc actggcctgc gcagtggcgt ggctggccga gcgctgggtc      1260
     ggcatggccg acctgtcgat ggtgttcatc gtggcggtgg tggtggtggc cgcgcgtacg      1320
     cgcgccagcg tggcggtgat ggcggcgatc ctgtgtttcc tcgcctacaa cttcctgttc      1380
     atcgcgccgc gcttcacctt cgccattggt gcgcgccagg gcgtgatcac cgtgttcctg      1440
     ttcctggccg ccgccttggt ggccggacgg ctggcctcgc gcctgcgcat gcaggtgatc      1500
     gcgctgcgtg cagccaaccg ccatgcgcgt gcgcgccagc agctgggccg tcagctcgcc      1560
     agtgcggccg gcaatggcga ggtcgcgcag gccggcaggc tggcgctgga gcaggcgatg      1620
     gacgttccgg catggctgcg cattggaaca gacaccgcgg ccggtggtcg cagccagccg      1680
     ggggacaccg atctggccgc cgccgactgg gcgctgcgcc atggccagcc cagcggccgc      1740
     ttcaccgata ccctggccgg tgcgcagtgg tggttcctgc cactgctgga tggcgaggac      1800
     cgcgccattg gcgtggccgg cctgtacctg cccggcgcgc aggcgcgcct gctgccggag      1860
     caacggcagc tggccgaggc aatggtcgat gacatcgccc aggccgcgct tcgcacacgg      1920
     ctggtggccg aactggaaca ggcgcacgtc agcaacgaga ccgagcggtt gcgctcggcc      1980
     ctgctctctt cggtgtcgca cgacctgcgc tcgccactgg cggcgatgat cggttcggcc      2040
     gacagcctgg ccagctacgg cgcggcaatg gacacgaccg atcgccgtgc cctgctcgat      2100
     accatcctgg tcgaaggcga acgcctggac cgctatatcc agaacctgct ggacatgacc      2160
     cggcttggcc acgaagggtt gaagatcaac cgcgactgga tcggcgtgga cgaactgatc      2220
     ggctcggcag cgcgacgcct gcagcgctat cagccgaagg tgcggctgga gctcgacatt      2280
     ccttcctcgc tggcgccgat ctgggtgcat ccggcgctgg tcgaacaggc ggtgttcaac      2340
     gtgatggaga acgcggccaa gttctcgccg cccgatgccg ccgtgcaggt acaggcgcgc      2400
     gagctggacg gccagctgcg catcgacgtg atcgatgccg gccccggcat tcccgacgac      2460
     gagcgtgcgc gcatcttcga catgttctac agcgtcgaac gcggtgaccg tggccgccat      2520
     ggcaccggcc tgggcctgac catctgccag ggcatgatcg gcgcgcatgg cggcagcgtg      2580
     caggcgctgc ccggacgcga tggtcgcggt accctgatcc gcatcaccct gcccctgctc      2640
     aagccagcct cccacgatga gtccgacccc gattga                                2676
//

If you have problems or comments...

PBIL Back to PBIL home page