(data stored in ACNUC7421 zone)

EMBL: CP001111.PE289

CP001111.PE289       Location/Qualifiers
FT   CDS_pept        complement(339624..340274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0289"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: xcv:XCV0810 potassium-transporting ATPase
FT                   subunit C; TIGRFAM: potassium-transporting ATPase, C
FT                   subunit; PFAM: K transporting ATPase KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49994"
FT                   /db_xref="GOA:B4STF1"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF1"
FT                   /protein_id="ACF49994.1"
FT                   /translation="MNRTASTSSSLPREQKAEARVASLQDGASWRPAIGLGLATLLLAG
FT                   AVYAGIATGFAGLAYPTQAEGSLLRDGNGQVRGSAWLSQPFTGDGYFQARPSAANYDPM
FT                   AAAGSNLARSNPALAERVAASTAAVAARESVAPAQVPADLVTQSAGGLDPQLSPAAAQL
FT                   QVARVARARGLPVERVQALVQAHTEGRQWGLFGQPRVNVVTLNFALDHAAKAP"
     atgaaccgta ctgcttccac ttcatcttcc cttccgcgcg aacagaaggc cgaggcccgc        60
     gtggccagcc tgcaggatgg tgccagctgg cgcccggcga tcggcctggg cctggccaca       120
     ctgctgctgg ctggcgcggt ctacgccggt atcgccaccg gttttgccgg cctggcgtac       180
     ccgacccagg ccgagggcag cctgctgcgc gatggcaacg gccaggtacg cggctcggcg       240
     tggctttcgc agccgttcac gggtgacggc tatttccagg cgcgtccgtc ggcggccaac       300
     tatgacccga tggccgccgc cggttccaac ctggcccgca gcaacccggc cctggccgaa       360
     cgtgttgccg ccagcactgc cgcggtcgcc gcacgcgaaa gcgtcgcccc ggcgcaggtg       420
     ccggcggacc tggtcaccca gtctgccggt ggcctggacc cgcagctgtc accggcggcg       480
     gcacagctgc aggtggcgcg cgtggcgcgt gcccgtggcc tgccggtgga gcgcgtgcag       540
     gccctggtgc aggcgcatac cgagggacgc cagtggggtc tgttcgggca gccacgggtg       600
     aacgtggtga cgctgaactt cgcacttgac cacgcggcca aggcaccgtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page