(data stored in ACNUC7421 zone)

EMBL: CP001111.PE290

CP001111.PE290       Location/Qualifiers
FT   CDS_pept        complement(340271..342328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0290"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   xcb:XC_3531 potassium-transporting ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49995"
FT                   /db_xref="GOA:B4STF2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF2"
FT                   /protein_id="ACF49995.1"
FT                   /translation="MSTQASSTRSTHAPRPALLDGAGLRRALIEAVLKLSPMHLVRSPV
FT                   MAVVMAGTIVAAIVTLTGNAPLGFGLAVTAILLVTVLFGNFAEAVAEARGRGQAASLRR
FT                   ARQDLVARRLATPQPGAAETQVPAAELRPGDHVIVSAGELVPADGEIVQGLATINEAAV
FT                   TGESAPVLREAGTDRSGVIGGTKVLSDQIIVRVTAEPGHSFLDRMIALVEGANRQKTPN
FT                   EIALTLLLAAMTLTFLVVVATLPAIGASVGVKVDPLLLIALLVCLIPTTIGGLLPAIGI
FT                   AGMNRALAANVLAKSGKAVEVAGDVDVLLLDKTGTITYGDRQASHFHPLAGIDASQLRE
FT                   AALLSSLADPTPEGKSIVRLAREQGCATAEPDHADYLAFSAQTRMSGVDLEHGRQIRKG
FT                   AADAIRAHVQALGGSVPAELAGRVEQVARNGATPLVVAEGRHVLGVIELSDVVKHGMRE
FT                   KFAQLRAMGIRTVMITGDNPLTAAAIAAEAGVDDYIAEARPEDKLARIRQEQAGGRLVA
FT                   MVGDGTNDAPALAQADIGLAMNSGTQAAKEAGNMVDLDSDPAKLLAVVEVGKQQLITRG
FT                   ALTTFSLANDVSKYFAILPALFAAAVPTMAALNVMQLSSPRNAVLAALIFNALVIPALI
FT                   PLALRGVRFRPATATALLRRNMLVYGLGGVLLPFAAIKAIDLLLVLVFGA"
     atgagtaccc aagcaagttc aacccgtagt acccatgcac cgcgccctgc cctgctggat        60
     ggcgccggcc tgcgccgtgc gctgatcgaa gcggttctca agctgtcgcc gatgcatctg       120
     gtgcgcagcc cggtgatggc ggtggtgatg gccggcacga tcgtcgccgc gatcgtcacc       180
     ctgaccggca atgcgccgct gggcttcggc ctggcggtga ccgcgatcct gctggtgacc       240
     gtgctgttcg gcaacttcgc cgaagccgtg gccgaagcgc gtggccgtgg ccaggccgcg       300
     tcgctgcggc gtgcccgcca ggacctggtg gcgcgccggc tggccacgcc gcagccgggt       360
     gccgccgaaa cccaggtgcc ggccgccgaa ctgcgcccgg gcgaccacgt gatcgtcagc       420
     gccggtgagc tggtgccggc cgatggcgag atcgtgcagg gcctggccac catcaacgaa       480
     gccgcggtga ccggcgaatc ggcgccggtg ctgcgcgagg ccggtaccga ccgctccggc       540
     gtgatcggcg gcaccaaggt gctgtccgac cagatcatcg tgcgggtgac cgccgaaccg       600
     ggccacagct tcctggaccg gatgatcgcg ctggtggaag gcgccaaccg ccagaagacc       660
     ccgaacgaga tcgcgctgac cctgctgctg gcggcgatga cgctgacctt cctggtggtg       720
     gtggcaacgc tgccggccat tggtgcctcc gtgggcgtca aggtcgaccc gctgttgctg       780
     atcgcgttgc tggtgtgcct gatcccgacc accatcggcg gcctgctgcc ggccatcggc       840
     atcgctggca tgaaccgtgc gctggccgcc aacgtgctgg ccaagtcggg caaggcggtg       900
     gaagtggccg gcgacgtcga cgtgctgctg ctggacaaga ccggcaccat cacctacggc       960
     gaccgccagg ccagccattt ccatccgctg gccggcatcg acgccagcca gctgcgcgaa      1020
     gcagcactgc tctcttcgct ggccgacccg accccggaag gcaagtcgat cgtgcgcctg      1080
     gcgcgcgaac agggctgcgc caccgccgag ccggaccatg ccgactacct ggccttcagt      1140
     gcacagaccc gcatgtccgg cgtggacctg gaacatgggc ggcagatccg caagggcgcc      1200
     gccgatgcga tccgtgccca cgtgcaggcg ctgggcggca gcgtgccggc tgaacttgcc      1260
     ggacgcgtgg agcaggtggc gcgtaacggt gccaccccgc tggtggtggc cgaaggtcgc      1320
     cacgtgctcg gcgtgatcga gctgtcggac gtggtcaagc acggcatgcg cgagaagttc      1380
     gcgcagctgc gggcgatggg catccgcacg gtgatgatca ccggcgacaa tccgctgacc      1440
     gccgccgcca tcgccgccga agccggcgtc gacgactaca tcgccgaggc tcgcccggag      1500
     gacaagctgg cacgcatccg ccaggaacag gccggtggcc gcctggtggc gatggtcggc      1560
     gatggcacca acgacgcacc ggcgctcgcc caggccgaca tcggcctggc aatgaactcc      1620
     ggcacgcagg cggcaaagga agccggcaac atggtcgacc tcgattcgga tccggccaag      1680
     ctgctggcag tggtggaagt gggcaagcaa cagctgatca cccgcggtgc gctgaccacc      1740
     ttctcgctgg ccaacgacgt ctccaagtac ttcgcgatcc tgccggcgct gttcgccgcc      1800
     gccgtgccga ccatggccgc attgaacgtg atgcagctgt cgagcccgcg caatgcggtg      1860
     ctggcggcgt tgatcttcaa cgccctggtg attcccgccc tgatcccgct cgccctgcgt      1920
     ggcgtgcgct tccgcccggc cactgcaacc gcgctgctgc gccggaacat gctggtgtac      1980
     ggcctcggcg gcgtgctgct gccgttcgca gcgatcaagg cgatcgacct tcttcttgtc      2040
     ctggtattcg gcgcatga                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page