(data stored in ACNUC7421 zone)

EMBL: CP001111.PE291

CP001111.PE291       Location/Qualifiers
FT   CDS_pept        complement(342339..344048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0291"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: xcb:XC_3532 potassium-transporting ATPase
FT                   subunit A; TIGRFAM: potassium-transporting ATPase, A
FT                   subunit; PFAM: K transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49996"
FT                   /db_xref="GOA:B4STF3"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF3"
FT                   /protein_id="ACF49996.1"
FT                   /translation="MTEIIVILAASLLLAWPLGLYLARVMRGAPMKVDVLFHWIEKPLY
FT                   RVFGVDPSRSMSWRGYVLAFVLSNVVVAVLTQAVFMTQAWLPLNPDQIPNMRWDTALHT
FT                   MISFLTNTNQQHYSGQAQLSYLSQMTGITGLQVVTPMMGLALAVATLRALFARSSQAAA
FT                   ASGAGDDRQVAVGNYYVDVVRLCVRFLLPLCLVWTLLLTSQGVPSTMAGGPQATPIDAS
FT                   AGMAEQKLPLGPVAAMVAAKQLGANGGGWYGPNSSFPLENPTPVSNALEILGILLVPMS
FT                   VIFMIGAFTGRRRFGVLVFSCMLGMSLLSTGAMVWSEGHSPSAATPLLMEGKEVRFGAD
FT                   GTALWAAVTTQVSNGSVNGMHDSLAPLSGGIAMVNMLVSAIWGGIGCGLQQFIVYLLLG
FT                   VFLAGLMTGRTPELFGRKLETPQVRLLALLVLLQPITLLVFTAITLAVPGLAGTSNPGF
FT                   HGISQVFYEYVSAYANNGSGFEGLGDATLWWNLSCSLVLLLGRFPLLIIPLVVAAQLAA
FT                   KRQSPESAGSLQIETPTFALTLVSVIVILTVLQFMPALVLGPIADHLSLGLH"
     atgactgaga ttattgtcat tcttgccgcc agcctgctgc tggcctggcc gttgggcctg        60
     tatctggcgc gcgtgatgcg tggcgcgccg atgaaggtcg acgtgttgtt ccactggatc       120
     gagaaaccgc tgtacagggt gttcggcgtc gacccgtcgc gctcgatgtc ctggcgcggc       180
     tacgtgctgg ccttcgtgct gagcaacgtg gtggtggcgg tgctgaccca ggcggtgttc       240
     atgacccagg cctggctgcc gctgaatccg gaccagatcc cgaacatgcg ctgggacacc       300
     gcgctgcaca cgatgatctc gttcctgacc aacaccaacc agcagcacta ttcgggccag       360
     gcgcagctgt cctacctctc gcagatgacc ggcatcaccg gcctgcaggt ggtgacgccg       420
     atgatgggcc tggcgctggc ggtggccaca ctgcgcgcgt tgttcgcgcg ttcgtcgcag       480
     gctgcagcgg ccagtggtgc cggtgatgac cgccaggtgg cggtgggcaa ctactacgtg       540
     gacgtggtgc gcctgtgcgt gcgcttcctg ttgccgcttt gcctggtgtg gacgttgctg       600
     ctgaccagcc agggcgtgcc gtcgacgatg gccggcggcc cgcaggccac gccgatcgac       660
     gccagtgccg gcatggccga acagaaactg ccgctgggcc cggtggcggc gatggtcgcg       720
     gccaagcagc tcggcgccaa cggtggcggc tggtacggcc cgaacagcag cttccctctg       780
     gagaacccga cgccggtttc gaatgcgttg gaaatccttg gcatcctgct ggtgccgatg       840
     tcagtgatct tcatgatcgg cgcattcacc ggccgacgcc gcttcggcgt cctggtgttc       900
     agctgcatgc tcggcatgtc gctgctgtcc accggcgcca tggtgtggag cgagggccac       960
     agccccagcg ccgccacgcc gctgctgatg gaaggcaagg aggtacgctt cggcgccgat      1020
     ggcaccgcgc tgtgggcggc ggtgaccacc caggtctcca acggttcggt caacggcatg      1080
     cacgattcgc tggcaccact gagtggcggc atcgcgatgg tcaacatgct ggtcagcgcg      1140
     atctggggcg gtatcggctg cggcctgcag cagttcatcg tgtacctgct gctgggcgtg      1200
     ttcctggccg ggttgatgac cgggcgtacg ccggaactgt tcggccgcaa gctggagacg      1260
     ccacaggtac gcctgctggc cctgctggtg ctgctgcagc cgatcaccct gctggtgttc      1320
     accgcaatca ccctggccgt gcccggcctg gccggcacct ccaaccccgg tttccatggc      1380
     atcagccagg tcttctacga gtatgtctcg gcctacgcca acaacggctc gggcttcgaa      1440
     ggactgggcg acgccacgct gtggtggaac ctgagctgct cgctggtgct gctgctgggc      1500
     cgcttcccgc tgctgatcat tccgctggtg gtggccgcac agctggccgc caagcgccag      1560
     tcgccggagt ctgccggcag cctgcagatc gaaaccccga ccttcgccct gaccctggtc      1620
     tcggtgatcg tcatcctgac cgtgctgcag ttcatgccgg cgctggtact cggcccgatc      1680
     gccgaccacc tgagcctggg actgcactaa                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page