(data stored in ACNUC7421 zone)

EMBL: CP001111.PE293

CP001111.PE293       Location/Qualifiers
FT   CDS_pept        complement(344373..345035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49998"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF5"
FT                   /protein_id="ACF49998.1"
FT                   /translation="MSRVPAVLFAGLLLAVPFAVPAQSRDSGKAEKKLYCWNEGKERIC
FT                   SDSLPADAVNHAREEFNAKSGLRNAQVQRALTDEERAAASTVAQQQQLDLMATQTRQRT
FT                   EQAMLSTYGSEDDLRRVFTERQEVLDNNLKTAEYNVTSLRESLVALLSAAGDRELAGGK
FT                   VADKQAEAIRQRHVQLQAQQRLQAGFLQQQQALKAEIDSSLQRYRELKGLVPADQAR"
     atgtcccgag ttcctgctgt tctctttgcc ggcctgctgc tggccgtgcc gttcgccgtg        60
     ccggcgcagt cgcgcgacag cggcaaagcg gaaaagaagc tgtactgctg gaacgagggc       120
     aaggagcgga tctgcagtga ttcgctaccg gccgatgcgg tcaaccatgc ccgcgaggag       180
     ttcaacgcga agagtggcct gcgcaacgcg caggtccagc gcgcgttgac cgacgaggag       240
     cgcgctgccg ccagcaccgt ggcgcagcag caacagctgg acctgatggc cacccagacc       300
     cgccagcgta ccgagcaggc gatgctgtcc acctatggca gcgaggacga cctgcgccgg       360
     gtgttcaccg agcgccagga agtgctggac aacaacctga agaccgccga gtacaacgtc       420
     accagcctgc gcgagtcgct ggtggcgctg ctgtcggccg ccggtgaccg tgagctggcc       480
     ggcggcaagg tggccgacaa gcaggccgag gcgatccgcc aacggcatgt gcagctgcag       540
     gcgcagcagc gcctgcaggc aggattcctg cagcagcagc aggcattgaa ggccgagatc       600
     gacagcagcc tgcagcgcta tcgcgagctg aaggggctgg tgccagcaga tcaggcccgc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page