(data stored in ACNUC7421 zone)

EMBL: CP001111.PE296

CP001111.PE296       Location/Qualifiers
FT   CDS_pept        346674..348047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0296"
FT                   /product="AmpG protein"
FT                   /note="KEGG: bba:Bd0333 AmpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50001"
FT                   /db_xref="GOA:B4STF8"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF8"
FT                   /protein_id="ACF50001.1"
FT                   /translation="MTEAAKPRRPWQQVVSNLSQRKVLAMLLLGFSSGLPIYLVGNTLG
FT                   FWMRKEGIELSTIGFLSWVGLAYTMKFLWAPIVDKTDVPLFGRFGRRRGWMLLSQLVVV
FT                   VGLVGMALVQPKGGHVHFLGIAWEHIVVFGVMAVIVAFASATQDIVIDAWRIESADNSE
FT                   QLGLLTSSSALGYRTALLVTDALILIIAARVGWQVSYEIMAVLMALGVVAVIMAREPAR
FT                   EVAAVQAQATSLWTPRGLFDAVAGPFIAFVREHRSGAILILVAISVYRMADFVMGPMAN
FT                   PFYVDLGLDEDTVGAVRGSVGLVATFVGIAAAGLVSVRWGVLAALLVGAVLGPASNLAF
FT                   AWLAYSGPDTTHFAVAMAVDNFASGFAGTALIAYMSSLTSIGYTATQYALLSSFYAMPG
FT                   KALKGLSGWSVQTLAQGRTLLEGYALFFIGTALVAIPVVILCGLLILQQRRRQTANPA"
     gtgaccgagg ctgccaagcc gcgtcggccg tggcagcagg tggtgtccaa cctgagccag        60
     cgcaaggtgc tggcgatgct gctgctcggc ttcagttccg gcctgccgat ctacctggtg       120
     ggcaatacgc tcggtttctg gatgcgcaag gaaggcatcg agctgagcac catcgggttc       180
     ctctcgtggg ttggcttggc ctacaccatg aagttcctgt gggcgcccat cgtcgacaag       240
     acagatgtgc ccctgttcgg ccgctttggc cgccgtcgcg gttggatgct gctgtcgcag       300
     ctggttgtgg tggtgggtct ggttggcatg gcgctggtcc agcccaaggg cggccacgtg       360
     catttcctgg gcatcgcctg ggagcacatt gtggtattcg gggtgatggc ggtgatcgtg       420
     gccttcgcct cggccactca ggacatcgtc atcgacgcgt ggcgcattga aagcgccgac       480
     aacagtgagc agctcggact tctcacctca tcctcggcac tgggctaccg cactgcattg       540
     ctggtcaccg atgcgctgat cctgatcatc gctgcccgtg ttggctggca ggtctcttac       600
     gagatcatgg ccgtgctgat ggcgctcggt gtggtggccg tgatcatggc ccgcgagccg       660
     gcccgcgagg ttgccgccgt acaggcacag gccacctcgc tgtggacccc gcgggggctg       720
     ttcgatgccg tggcgggccc cttcatcgcc ttcgtccgcg aacaccgcag tggcgcgatc       780
     ctgatactgg tggcgatcag cgtctaccgc atggccgact tcgtcatggg gccgatggcc       840
     aacccgttct atgtcgatct tggcctggat gaggacaccg tcggtgcggt gcgcggctcg       900
     gttggcctgg ttgcaacctt cgtcggcatt gctgctgcag gcctcgtctc ggtgcgctgg       960
     ggcgtgctgg cagcgctgct ggtgggagcg gtactggggc cggcctccaa cctggccttc      1020
     gcatggctgg cctactcggg gccggacacc acccatttcg ccgtagccat ggcggttgac      1080
     aacttcgcca gcggtttcgc cggtacggcg ctgatcgcct atatgtccag cctgaccagc      1140
     atcggataca ccgcgaccca gtacgccttg ctcagctcgt tctatgcgat gcccggcaag      1200
     gcattgaaag ggctctcggg ttggtcggtg cagaccctcg cgcagggacg gacgcttctg      1260
     gaaggctatg cgctgttctt catcggcacg gcgctggtag cgatcccggt ggtgatcctg      1320
     tgcggactgc tgatcctgca gcagcgccga cgccaaactg ccaaccccgc ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page