(data stored in ACNUC7421 zone)

EMBL: CP001111.PE297

CP001111.PE297       Location/Qualifiers
FT   CDS_pept        348126..348356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50002"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF9"
FT                   /protein_id="ACF50002.1"
FT                   /translation="MADVVLRDLDPLLLERIRRVGVARGWTHEQTCEALLEQGLFSSEL
FT                   EVRSGFGDPEVDALSDAIAALQALPAGQGFD"
     atggccgacg ttgtgctgcg ggacctggac ccgctgttgc tggaacgcat ccgacgggtc        60
     ggggtcgctc gcggctggac ccacgaacag acctgcgagg ccctgctgga gcagggcttg       120
     ttcagcagtg aactggaagt ccgttccggc ttcggtgatc ccgaagtgga tgcgctctcc       180
     gatgccatcg ccgccctgca ggccctgccc gcagggcagg gcttcgactg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page