(data stored in ACNUC7421 zone)

EMBL: CP001111.PE298

CP001111.PE298       Location/Qualifiers
FT   CDS_pept        complement(348463..349599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0298"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   xcb:XC_3927 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50003"
FT                   /db_xref="GOA:B4STG0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG0"
FT                   /protein_id="ACF50003.1"
FT                   /translation="MPAMNTTADSDAPLYLGLMSGTSADGIDAALVQFPASGGCRFVHG
FT                   LTARWEPVLRARLVALGEGGPLDSLEELGELDARIAIRFAEAANQLLAEAGVDRSQVRA
FT                   IGSHGQTVRHRPLADPAFTVQLGDGNRIAELTGITTVCDFRRRDVAAGGHGAPLMPAFH
FT                   LGMLGTADEDRAVLNLGGIANLTLIPREGAVRGFDTGPANALMDAWCQRHTGRTFDADG
FT                   AYAASGAVDEGLLAGWRSDPWFALPPPKSTGREQFHLAWAEAHMGEGQYAAADIQATLL
FT                   ELTVATVVDALLAQQPRTRRLLVCGGGMRNTQLMRRLAAQLPGVVVESSAVHGLDPEYV
FT                   EAMGFAWLAQRTMDGLAGNLPSVTGAKGPRILGAIHLA"
     atgcctgcca tgaacacgac tgccgacagc gacgcccccc tgtaccttgg cctgatgtcg        60
     ggcaccagcg ccgacggcat cgatgccgca ctggtgcagt tccccgccag tggtggctgc       120
     cgcttcgtgc atgggctgac cgcccgctgg gagccggtgc tgcgcgcgcg gctggtggcg       180
     ctgggcgaag gcgggccgct ggattcgttg gaagagctcg gcgaactgga cgcgcggatt       240
     gcgatccgtt ttgccgaggc ggccaaccag ctgctggccg aggctggcgt ggaccgcagc       300
     caggtgcgcg cgatcggctc gcatgggcag accgtgcgcc accggccact ggccgacccg       360
     gcgttcaccg tgcagctggg cgacggcaac cgcatcgccg agctgaccgg gatcaccacg       420
     gtgtgtgatt tccgccgccg cgacgtggca gccggaggcc atggtgcgcc gctgatgccg       480
     gcattccatc tgggcatgct gggcactgcc gatgaagacc gcgccgtgct gaacctgggc       540
     ggcatcgcca acctgaccct gatcccgcgc gagggcgcgg tacgtggctt cgataccggc       600
     ccggccaacg cgctgatgga tgcctggtgc cagcgccaca ccggccgcac cttcgacgcc       660
     gatggcgcgt atgcggccag tggcgcggtg gacgagggcc tgctggcggg ttggcgctcg       720
     gatccgtggt tcgcgctgcc gccgccgaag agcaccggcc gcgagcagtt ccacctggcc       780
     tgggccgagg cgcacatggg cgaaggccag tacgccgccg ccgacataca ggccacgttg       840
     ctggagctga cagtggcgac ggtggtcgat gcgctgctgg cgcagcagcc gcggacacgg       900
     cgactgctgg tatgtggtgg cggcatgcgc aatacgcagc tgatgcggcg actggcggcg       960
     cagctgccgg gggtggtggt cgaatccagc gcagtgcacg ggctggaccc ggaatacgtg      1020
     gaggcgatgg gcttcgcgtg gctggcacag cggacgatgg acggactggc cggcaacctg      1080
     ccgagcgtga ccggggcgaa gggcccgcgg atcctgggcg cgatccacct ggcctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page