(data stored in ACNUC7421 zone)

EMBL: CP001111.PE3

CP001111.PE3         Location/Qualifiers
FT   CDS_pept        3921..5015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: xcb:XC_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49708"
FT                   /db_xref="GOA:B4SR07"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SR07"
FT                   /protein_id="ACF49708.1"
FT                   /translation="MQIRRLALHQLRRFNAVELSPQPGLNLLTGDNGAGKTSILEALHL
FT                   MAYGRSFRGRVRDGLVRQGQEALEIFVEWDEQRASHPPHRRKAGLRHSGQDWKGRLDGE
FT                   DVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHVEPDFLSLWRRYSRALK
FT                   QRNALLKQGGPSRMLDTWDHELAEAGEPLTSRRQHYLERLQQRTVALAAELAPQLGIQA
FT                   MELSPGWRRHELPLADALLLARERDRQAGYTSVGPHRADWSVDFHNIPGRDALSRGQAK
FT                   LTALACLLAQAEDYAEQRGEWPVIALDDLASELDRTHQARVLERLLGGPAQIFVTATET
FT                   PAALQELTHIARFHVEHAQIVAVP"
     atgcagatcc gccgccttgc cttgcaccaa ctgcgtcgct tcaatgcggt ggagctctct        60
     ccgcagccgg gcttgaacct gctgaccgga gacaacggcg ccggcaagac cagcattctt       120
     gaggccctgc acctgatggc ctatgggcgc agcttccgcg gccgggtacg tgatggtctg       180
     gtccgtcagg gccaggaagc gttggagatc ttcgtggaat gggatgaaca gcgcgccagc       240
     caccctcctc atcggcgaaa ggccggtctg cgccacagtg gccaggactg gaagggacga       300
     ttggatggcg aagacgttgc ccagctcggc aacctctgtg ctgccttggc ggtggtgacc       360
     tttgaaccag gcagccacgc actggtcagc gggggcggcg aaccccgccg ccgattcctc       420
     gattggggct tgttccacgt ggaaccggat tttctatccc tgtggcgccg ctactcccgg       480
     gcgctcaagc aacgcaatgc actgctcaaa cagggcgggc cttcgcggat gctggatacc       540
     tgggaccacg agctggccga ggcaggcgaa ccgctgacca gccgccgcca gcactatctg       600
     gaacggctgc agcaacggac cgtggcactt gcggcggaac tggctcccca gctgggtatc       660
     caggcgatgg aactgagtcc gggctggcgt cgccacgagt tgccgttggc cgatgcgctg       720
     ctgctggccc gcgaacgcga ccggcaagcg ggctacacct ccgtcgggcc gcaccgggcg       780
     gactggagcg tggacttcca caacattcct ggccgtgatg cgctgtcccg tggccaggcc       840
     aagctgacag ccctggcctg cctgctggcc caggccgaag actatgcgga acagcgcggg       900
     gaatggccgg tcatcgccct ggatgacctg gcctcggagc tggatcgtac ccaccaggca       960
     cgggtactgg agcgcctgct cggcgggccg gcccagatat tcgtcaccgc caccgaaacc      1020
     ccggcggcgc tgcaggagct gacccatatc gcccggttcc acgtggaaca tgcacagatc      1080
     gtggctgtgc catag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page