(data stored in ACNUC7421 zone)

EMBL: CP001111.PE300

CP001111.PE300       Location/Qualifiers
FT   CDS_pept        351295..352506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0300"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: xac:XAC3897 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib; RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50005"
FT                   /db_xref="GOA:B4STG2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG2"
FT                   /protein_id="ACF50005.1"
FT                   /translation="MSSIEEALALIGRGADEILKLEDLRARLQEGRPLRIKAGFDPTAP
FT                   DLHLGHTVLLNKMRQFQDLGHQVIFLIGDFTGMIGDPSGKSLTRKPLSKDDVLANARTY
FT                   EEQVFKVLDRSRTEVRFNSEWFGKMGAADMIRLAGQHTVARMLERDDFAKRYAAQQSIA
FT                   IHEFLYPLVQGYDSVALEADVELGGTDQKFNLLMGRGLQEHHGQKPQVVLTMPLLEGLD
FT                   GVNKMSKSLGNYIGISEPAIDIVTKTMKVDDTLMWRWIELLSFDISQAEAVQLREQVAN
FT                   GGLNPRVVKLRLARELATRFHDAAAAEQAVAGWEAAVTGQGDITQLPLQDVAIPAEGLR
FT                   IAALLTAAGLTPSNSEANRKLKERAVKVDGEVVEDGQQVLQPGFEGLLQVGKRTFARVR
FT                   LVAA"
     gtgtcctcga ttgaagaagc ccttgccctg atcggccgtg gtgccgacga gatcctcaag        60
     ctcgaggatc tgcgtgcgcg cctgcaggaa ggccgcccgc tgcggatcaa ggccggcttc       120
     gaccccaccg cgcccgacct gcacctgggc catacggtgc tgctgaacaa gatgcgccag       180
     ttccaggacc tcggccatca ggtcattttc ctgatcggcg acttcaccgg catgatcggc       240
     gacccgtccg gcaagagcct gacccgcaag ccgctcagca aggacgacgt gctggccaat       300
     gcccgtacct atgaagagca ggtgttcaag gtgctggacc gcagccgtac cgaagtccgc       360
     ttcaactcgg agtggttcgg caagatgggc gcggccgaca tgatccgcct ggccggccag       420
     cacaccgtgg cgcgcatgct cgagcgcgac gatttcgcca agcgctacgc cgcccagcag       480
     tccatcgcca tccacgagtt cctgtacccg ctggtgcagg gctacgactc tgtggccctg       540
     gaagcggacg tcgagctcgg cggtaccgac cagaagttca acctgctgat gggccgcggc       600
     ctgcaggagc accacggcca gaagccgcag gtggtgctga ccatgccgct gctggaaggc       660
     ctggatggcg tcaacaagat gtccaagtcg ctgggcaact acattggtat cagcgagccg       720
     gccatcgaca tcgtcaccaa gaccatgaag gtggacgaca ccctgatgtg gcgctggatc       780
     gagctgctgt ccttcgacat cagccaggcc gaagccgtgc agctgcgcga gcaggtggcc       840
     aatggcggcc tgaacccgcg cgtggtcaag ctgcgcctgg cgcgtgaact ggcgacccgc       900
     ttccatgacg ccgcagcggc cgaacaggcg gttgccggtt gggaggcggc ggtgaccggg       960
     cagggcgaca tcacccagct gccgctgcag gacgtggcga tcccggccga aggcctgcgc      1020
     atcgccgcgc tgctgacggc ggccggcctg accccgagca actccgaagc caaccgcaag      1080
     ctcaaggagc gtgcggtcaa ggtggacggt gaagtggtgg aagacggcca gcaggtgctg      1140
     cagccgggct tcgaaggcct gctgcaggtc ggcaagcgca ccttcgcccg cgtgcgcctg      1200
     gtcgctgcct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page