(data stored in ACNUC7421 zone)

EMBL: CP001111.PE301

CP001111.PE301       Location/Qualifiers
FT   CDS_pept        complement(364491..366206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0301"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; KEGG: xcb:XC_0024 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50006"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG3"
FT                   /protein_id="ACF50006.1"
FT                   /translation="MPRKLLLCLAAAAALSACKGEDTPAPAPATDTAAAKPAAHSFSPE
FT                   INAGDFAEMVKTLASDEFEGRAPGSKGEELTVNYIRDQMQRIGLQPGNGDSWFQDVPMT
FT                   ETTANESTVLKITQGGKTTELKFGTDMVVGTRTGQAEVKVDASDLVFVGYGVDAPEQKW
FT                   NDYAGQDWKGKTVVMFVNDPGFHVDDAKLFDGKRMTYYGRWTYKFEEAARKGAAAALIV
FT                   HDSAGASYGWDVVKNSWAGPQYDLPAKDDPEARIPVQGWLSADAAKTLFAGAGLDLAQA
FT                   YKDASKRGFKPVPLKATAAVDLKSQIAQKQSRNVVGVLPGSKRADEAVLYMAHWDHLGK
FT                   HEGETGDNIYNGAVDNATGVAGILEVAEAMAHQDPKPERSVVFLAVTLEESGLLGSKYY
FT                   VAHPTFPLDKIAGVINIDAMSVAGRAKDVTVTGFGSSELEDILKPLAAAQDRTLHGETS
FT                   VQSGFYFRSDHFNFAKAGVPALYADGGEDLRDGGVDAGRKAAADYGANRYHGPKDEFDA
FT                   ATWKLDGTVEDLQLMYGVGKELAGGDRWPNWYAGNPFKAARDAMMKDKAPAAAK"
     atgccccgca aactcctcct gtgcctggcc gctgcggccg cgctcagtgc ctgcaaaggc        60
     gaagatactc cggcgcccgc gccggccacc gacaccgccg ctgcgaagcc ggccgcccat       120
     tcgttctcgc cggaaatcaa cgccggcgac ttcgccgaaa tggtcaagac cctggcctcg       180
     gatgaattcg aaggccgcgc cccgggcagc aagggcgaag aactgacggt caactacatc       240
     cgcgaccaga tgcagcgcat cggcctgcag cccggcaacg gcgacagctg gttccaggac       300
     gtgccgatga ccgagaccac ggccaacgaa tcgaccgtgc tgaagatcac ccagggcggc       360
     aagaccaccg agctgaagtt cggcaccgac atggtggtgg gcacccgtac cggccaggcc       420
     gaagtgaagg tcgatgccag cgacctggtg ttcgtcggct acggcgtaga tgcgccggag       480
     cagaagtgga acgactacgc cggccaggac tggaagggca agacggtcgt catgttcgtc       540
     aatgacccgg gcttccacgt cgatgacgcg aagctgttcg acggcaagcg catgacctac       600
     tacggccgct ggacctacaa gttcgaggag gccgctcgca agggcgccgc cgccgcgctg       660
     atcgtgcacg actccgccgg cgcctcctat ggctgggacg tggtgaagaa ctcctgggcg       720
     ggcccgcagt acgacctgcc ggccaaggat gacccggaag cccgcatccc ggtgcagggc       780
     tggctgagtg ccgacgccgc caagacactg ttcgccggtg ccggcctgga cctggcgcag       840
     gcgtacaagg acgccagcaa gcgcggcttc aagccggtgc cgctgaaggc caccgctgcg       900
     gtcgatctga agagccagat cgcgcagaag caatcgcgca acgtggtggg cgtactgccg       960
     ggcagcaagc gtgccgacga ggccgtgctg tacatggcgc actgggatca cctgggcaag      1020
     cacgagggcg agaccggcga caacatctac aacggtgcgg tcgacaacgc gaccggtgtg      1080
     gccggcatcc tcgaggtggc tgaagcaatg gcccaccagg atccgaagcc ggagcgttcg      1140
     gtggtgttcc tggccgtgac cctggaagaa tccggcctgc tgggttcgaa gtactacgtc      1200
     gcgcatccca ccttcccgct ggacaagatc gccggcgtga tcaacatcga tgcgatgtcg      1260
     gtggctggcc gtgccaagga cgtgaccgtc accggcttcg gcagctcgga gctggaagac      1320
     atcctcaagc cgctggccgc ggcccaggac cgtaccctgc acggtgagac ctcggtgcag      1380
     agcggcttct acttccgttc cgaccacttc aacttcgcca aggccggcgt gccggctctg      1440
     tacgccgatg gcggcgagga cctgcgcgac ggtggcgtgg acgcgggccg caaggccgca      1500
     gcggactacg gcgccaaccg ctaccacggc ccgaaggacg agttcgacgc ggccacctgg      1560
     aagctggacg gtactgtcga agacctgcag ctgatgtacg gcgtcggcaa ggaactggcc      1620
     ggcggcgatc gctggccgaa ctggtatgca ggcaacccgt tcaaggcggc ccgcgatgca      1680
     atgatgaagg acaaggcccc ggctgcggcg aagtag                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page