(data stored in ACNUC7421 zone)

EMBL: CP001111.PE303

CP001111.PE303       Location/Qualifiers
FT   CDS_pept        367051..368349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0303"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: xom:XOO_4323 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50008"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG5"
FT                   /protein_id="ACF50008.1"
FT                   /translation="MRNNAFPSRRHHIAAIRGGRCLLLGLALALALPLPGAAQTTRETE
FT                   RKLQKLRTELKGVAQERRQIEGQRGQASQQLRDADEKVARSGRALAQTESALREQSQAL
FT                   AEAEQRRSTLQTNLAQQHRELAGLLRAAYQLGNHAPLKLLLSQDTVADANRALAYHRYL
FT                   QRERAQRITTLTADLKELEALQAQIAERRQKLQGSQRDQKQQAATLAADRRDRAQTVAS
FT                   LDERFKDKREKEQALGQDAKALETLLANLRAAAARAEAERRAAARRAAAEKAAAERAAR
FT                   QAAAQGRPPPPTKVPPAVASAPAPKVGGLGWPLSGNLLARYGGKLPDGRTSSGVLIGAP
FT                   AGSTVTAVADGTVVFSDWMTGYGMILIVDHGNGYMSLYAHNDTLLKDAGARVSRGDAVA
FT                   KVGNSGGQGVTALYFELRRGGQPVNPDSWLQRR"
     ttgcgcaaca acgccttccc atcacgccga catcacatcg ccgccatccg cggcgggcgc        60
     tgcctgctgc tggggctggc gttggccctg gccctgccgt tgcccggtgc tgcgcagacc       120
     acccgcgaga ccgagcgcaa gctgcagaag ctgcgcaccg aactgaaggg cgtggcgcag       180
     gagcgccggc agatcgaggg gcagcgcggc caggcctcgc agcagttgcg cgacgccgac       240
     gagaaagtcg cgcgcagtgg ccgcgccctc gcgcagactg aaagcgcctt gcgcgaacag       300
     agccaggcgc tggccgaggc cgagcagcgc cgcagcaccc tgcagaccaa cctggcccag       360
     cagcaccgcg agctggccgg gttgctgcgc gcggcctacc agctgggcaa ccacgcaccg       420
     ctgaaactgc tgctgtcgca ggatacggtg gccgacgcca accgcgccct ggcctaccac       480
     cgttacctgc agcgcgaacg cgcgcagcgc atcaccacgc tgactgccga cctgaaggaa       540
     ctggaggcgc tgcaggcgca gatcgccgag cgccggcaga agctgcaggg cagccagcgc       600
     gaccagaagc agcaggccgc caccctggcg gccgatcgac gtgaccgcgc gcagaccgtg       660
     gcttcgctgg acgagcgctt caaggacaaa cgcgagaagg aacaggcgct gggccaggat       720
     gccaaggcgc tggaaacgct gctggccaac ctgcgtgcgg ctgccgcccg tgccgaagcc       780
     gagcgtcgag ccgccgcgcg tcgagccgcc gccgaaaagg ccgcggccga acgtgccgca       840
     cgccaggccg ccgcgcaggg ccggccgccg ccgcccacca aggtcccgcc tgccgtggcc       900
     tcggcacctg cgccgaaggt tggaggcctg ggctggccgt tgtccggcaa tctgctggcg       960
     cgctacggcg gcaagttgcc tgacggccgc accagcagcg gtgtgctgat cggcgccccg      1020
     gccggcagta ccgttactgc cgtggccgat ggcaccgtgg tgttctccga ttggatgacc      1080
     ggctacggca tgatcctgat cgtcgaccac ggcaatggct acatgagcct ctacgcgcac      1140
     aacgacaccc tgctcaagga cgccggcgcc cgggtcagcc gcggcgacgc ggtggccaag      1200
     gtcggcaatt ccggcggcca gggcgtgacc gcgctgtact tcgagctgcg gcgtggcggg      1260
     cagccggtca atccggacag ctggctgcag cggcgctga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page