(data stored in ACNUC7421 zone)

EMBL: CP001111.PE304

CP001111.PE304       Location/Qualifiers
FT   CDS_pept        368458..369954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0304"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: xom:XOO_4322 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50009"
FT                   /db_xref="GOA:B4STG6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG6"
FT                   /protein_id="ACF50009.1"
FT                   /translation="MRAARTATLLLALLPALSWAQQTAPAPSQETSGQAANSEEAVTSK
FT                   VPLEDIRRFVAVYNAVRAAYVDPVDDKKLMQSAVRGLLLDLDPHSTYFNKEDAQAFDEQ
FT                   ASGAYEGIGVELQQQPDNASMKVISPIDDTPAAKAGILAGDLIIAIDGKPISKIDASEP
FT                   LRGAAGSKVVLTIVREGKPKPFDVSLTRQTIRVTSVRSRLLEPGYGYIRLSTFQADTGS
FT                   DFQKHVQQLQKQSGGQLKGLVLDLRSNPGGLLTAAVQVADDLLDKGNIVSTRGRISISD
FT                   ARFDATPGDLLKGAPVVVLVDAGSASASEVLAGALRDNKRARVVGSRTFGKGSVQTVLP
FT                   LDNGDSVKLTTARYYTPSGKSIQATGIVPEVELKPAATPVEDALPASLSDYSEATLPGH
FT                   LRGDDEGTEGYHAGAVLPGDGPINDALAELKNPGSVAARLKAEAAKAAAAKGAKAAAAK
FT                   PEATPDAKAEPKAESKPEAKPEAKPEAKPEAKPAPAPAKP"
     atgcgcgcag cccgtaccgc caccctcttg ctggctctgt tgccagcgct gtcctgggcg        60
     cagcagaccg cgcccgcccc gagccaggaa accagcgggc aggcggcgaa cagcgaggag       120
     gcggtgacct cgaaggtgcc gctggaagac atccgccgtt tcgtggcggt ctacaacgcg       180
     gttcgcgccg cctacgtcga tccggtcgat gacaagaagt tgatgcagtc ggcggtgcgc       240
     ggcctgctgc tcgaccttga tccgcacagc acctatttca acaaggaaga cgcgcaggcc       300
     ttcgacgagc aggccagcgg cgcctatgaa ggcatcggcg tggagctgca gcagcagccg       360
     gacaacgcca gcatgaaggt gatctcgccg atcgacgaca caccggcggc gaaggccggc       420
     atccttgccg gtgatctgat catcgccatc gacggcaagc cgataagcaa gatcgacgcc       480
     agcgaaccgc tgcggggcgc cgccggcagc aaggtggtgc tgaccatcgt gcgcgagggc       540
     aagccgaagc cgttcgatgt cagcctcacc cggcagacca tccgtgtgac cagcgtgcgc       600
     agccgcctgc tggaaccggg ctatggctac atccgcctga gtacctttca ggccgacacc       660
     ggttctgatt tccagaagca tgtgcagcag ctgcagaagc agtccggcgg ccagctcaag       720
     ggcctggtgc tggatctgcg cagcaacccg ggtggcctgc tgaccgccgc cgtgcaggtg       780
     gccgacgacc tgctcgacaa gggcaacatc gtcagcaccc gcggccgcat cagcatcagc       840
     gatgcacgtt tcgatgcaac gccgggcgat ctgttgaagg gcgcaccggt ggtggtgctg       900
     gtcgacgccg gatcggccag cgcatcggaa gtgctggccg gcgcgctgcg cgacaacaag       960
     cgtgcccgcg tggtcggcag ccgcaccttc ggcaagggct cggtgcagac cgtgctgccg      1020
     ctggacaacg gcgattcggt gaagctgact accgcgcgtt actacacgcc cagcggcaag      1080
     tcgatccagg ccaccggcat cgtgccggag gtcgaactga agccggccgc tacgccggtc      1140
     gaggatgcac taccggccag cctgagcgac tacagcgaag cgaccctgcc gggccatctg      1200
     cgcggtgacg acgaaggcac cgagggctac cacgccggtg cggtactgcc gggcgatggc      1260
     ccgatcaacg acgcgctggc cgagctgaag aacccgggtt cggtggctgc acgtctgaag      1320
     gccgaggcag cgaaggccgc tgcggccaag ggtgcgaagg cggcggccgc gaagccggag      1380
     gccacgccgg atgcgaaggc cgagccgaag gcggagagca agccggaagc aaagccggaa      1440
     gcaaagccgg aagcaaagcc ggaagcaaag cccgctccgg cccctgccaa gccctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page