(data stored in ACNUC7421 zone)

EMBL: CP001111.PE306

CP001111.PE306       Location/Qualifiers
FT   CDS_pept        370983..372332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0306"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: xcb:XC_0017 outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50011"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG8"
FT                   /protein_id="ACF50011.1"
FT                   /translation="MQTASTIARLTLLAVGVAGALAAADANAAAFQLKENSAKGLGRAF
FT                   AGSGSAEGDASIIAVNPAGMRQLEGTMVQGDLSAISFKAEFKGQGRNAAGRPQTGGDGG
FT                   DAGMIAPVPAAYFHMPIGEKAHFGVSLTAPFGFKTEYDNGWVGRYSGLKTDLKAIDLGF
FT                   AASYDVNPYVSFGASVFVEHLTIELSNAVDYGSILAGAGAPGFAPGSSDGTLKIEGDNN
FT                   AVGWTVGGLFSIDENTHIGLSYRSKVEHKITGGDATFSGADRARSLLTNSPRTRGWFMD
FT                   TSGKATVTMPASATLSVTHKVNDRWTVMGDVTRTAWSTAFDSVTVDYASPQPDSVLEFG
FT                   YRDTTFVSLGADYKLSDTVTLRGGVALDQTPTTDAHRDVRVPDTSRKWLSLGVGWTPSA
FT                   NTEYNFGYTHLFTSDPNVNVPATTANQGNSLSGKYKVRGDVLAASFQYKF"
     atgcaaaccg cttccaccat tgcccgactg accctgctgg ccgtcggcgt tgccggtgcg        60
     ctggccgccg ccgatgccaa cgctgccgcc ttccagctga aggaaaacag cgccaagggc       120
     ctcggccgcg cgttcgccgg ttccggcagc gccgagggcg acgcctccat catcgccgtc       180
     aacccggccg gcatgcgcca gctggaaggc acgatggtcc agggcgacct gagcgccatc       240
     agcttcaagg ccgagttcaa gggccagggc cgcaatgcgg caggccgccc gcagaccggt       300
     ggtgacggcg gcgacgccgg catgatcgct ccggtcccgg ctgcgtactt ccacatgccg       360
     atcggcgaga aggcccactt cggtgtgtcg ctgaccgcac cgttcggctt caagaccgaa       420
     tacgacaacg gttgggtcgg tcgctacagc ggcctgaaga ccgatctgaa ggccatcgac       480
     ctcggcttcg ccgcgtcgta tgacgtcaac ccgtacgtgt cgttcggcgc gtcggtgttc       540
     gtcgagcacc tgaccatcga gctgagcaac gccgttgact acggcagcat cctggccggc       600
     gccggcgctc cgggcttcgc cccgggcagc tcggatggca ccctgaagat cgagggtgac       660
     aacaatgccg tgggctggac cgtcggtggt ctgttctcga tcgacgagaa cacccatatc       720
     ggcctgagct accgttcgaa ggtcgagcac aagatcaccg gtggtgatgc gaccttcagc       780
     ggcgccgacc gcgcccgttc gctgctgacc aactcgccgc gtacccgtgg ctggttcatg       840
     gacaccagcg gcaaggccac ggtgaccatg ccggcctcgg ccaccctgag cgtgacccac       900
     aaggtcaacg accgctggac cgtgatgggc gacgtgaccc gcaccgcctg gtcgaccgcg       960
     tttgacagcg tgaccgttga ctacgcttcg ccgcagcccg attcggttct ggagttcggc      1020
     taccgcgaca ccaccttcgt gtcgctgggc gccgactaca agctgagcga caccgtcacc      1080
     ctgcgcggtg gtgttgcact ggaccagacc ccgaccaccg acgcacaccg cgacgtgcgc      1140
     gtgccggata ccagccgcaa gtggctgtcg ctgggcgtgg gctggacccc gtcggcaaac      1200
     accgagtaca actttggcta cacccacctg ttcaccagcg atccgaacgt gaacgtgccg      1260
     gcgaccactg ccaaccaggg caattcgctg tcgggcaagt acaaggtccg tggcgacgtg      1320
     ctggcggctt cgttccagta caagttctga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page