(data stored in ACNUC7421 zone)

EMBL: CP001111.PE31

CP001111.PE31        Location/Qualifiers
FT   CDS_pept        36856..37911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0031"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: xcv:XCV0151
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49736"
FT                   /db_xref="GOA:B4SR35"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR35"
FT                   /protein_id="ACF49736.1"
FT                   /translation="MSVRIISDAALPASKGKAATINDIARLSGVSKKTVSRIINNSPLV
FT                   RKDTRDKVEALMREVGYVPDPLARGLAFRRSFLIGLVYDDPGAQCIVDLQQGALEALRG
FT                   TGYELVVHPCDSQSADCAQGVRRFVQQQKLHGVILGPRASESVALTGMLDEIECRYIRI
FT                   NAHASDDEAQAVVTHDRDGAAAAAGYLLSLGHRDIAVITGPGDRRTARERTHGFLDRLA
FT                   QVGLTLPGERVLEAGDTFESGVHAAERLLMGEGRPSAIFAGNDEMAAGVYQVALRAGIA
FT                   VPQQLSIVSYDDSPLASRLWPPLTSVRRHVSDIGRMAAAMLVQTDVPEAPTAASVHPQL
FT                   MVRGSCRAVEG"
     atgtcagtgc gaattattag cgatgccgcg ttgccggcat cgaagggcaa ggctgccacg        60
     atcaacgaca tcgcacgact gtcgggagtt tccaagaaaa cggtttcaag aatcatcaac       120
     aactcgccgc tggtgcgcaa agacacccgc gacaaggtcg aggcgttgat gcgcgaggtc       180
     ggttacgtgc ccgacccgct ggcgcgcggg ctcgcgttcc gccgctcctt cctgatcggc       240
     ctggtgtatg acgacccggg cgcccaatgc atcgtcgacc tgcagcaggg cgcactggaa       300
     gcgctgcgcg gcaccggcta tgagctggtg gtgcatccct gcgacagcca gtccgcggac       360
     tgcgcgcagg gcgtgcggcg cttcgtgcag cagcagaaac tgcatggcgt gatccttggc       420
     ccgcgcgcct ccgagtcggt ggcgctgact ggaatgctcg acgagatcga atgccgctac       480
     atccgcatca acgcgcatgc ctcggacgac gaagcacagg cggtggtcac ccacgatcgc       540
     gacggtgcag ccgcggctgc gggctacctg ctctcgctcg gccaccgcga catcgcggtg       600
     attaccggtc cgggcgaccg ccgtaccgca cgcgagcgca cccatggctt cctcgaccgg       660
     ttggcccagg tgggcctgac cctgccgggt gagcgcgtgc tggaagcagg cgatacgttc       720
     gagtcgggcg tgcatgccgc cgagcgcctg ctgatgggcg aaggacggcc cagtgcgatc       780
     ttcgccggca acgatgaaat ggcggccggc gtgtaccagg tggcgttgcg tgcgggcatc       840
     gcggtgccgc agcagttgtc gatcgtcagc tacgacgaca gcccgctggc gtcgcggttg       900
     tggccgccgc tgacctcggt gcgccgccac gtctccgaca tcggccgcat ggccgccgcg       960
     atgctggtgc agaccgacgt accggaggcg ccgactgcgg ccagcgtgca tccgcagctg      1020
     atggtgcgtg gttcctgccg ggctgtggaa ggctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page