(data stored in ACNUC7421 zone)

EMBL: CP001111.PE310

CP001111.PE310       Location/Qualifiers
FT   CDS_pept        377117..378079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0310"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xac:XAC3888 cytochrome c oxidase subunit II;
FT                   TIGRFAM: cytochrome c oxidase, subunit II; PFAM: cytochrome
FT                   c oxidase subunit II; cytochrome C oxidase subunit II
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50015"
FT                   /db_xref="GOA:B4STH2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH2"
FT                   /protein_id="ACF50015.1"
FT                   /translation="MKQSRGWGTKCVAMVATMAALLSMPGTALAQAADPKPWQLNMGKG
FT                   VTQTSRLAWESNNLSLIVCTVIGVIVFGAMAYAMFKFRKSKGAVAATFSHNTKAEIIWT
FT                   VIPVIILVVMAWPATANLIKMYDTRDAEMTVKVTGYQWMWKYEYLGENVTFTSRLDRES
FT                   DRVRQSGVVPTRESHPHYLLDVDNRLVLPVDTKVRFVITSDDVIHAWWVPALGWKQDAI
FT                   PGFINEAWTSIEQPGVYRGQCAELCGKDHGFMPIVVEAVSKEEFKQWLAQRKPAPPAGP
FT                   ATPAAPAEPAAPAAPASEAPAAPAAAEAGSAPATAASGA"
     atgaagcaaa gcagagggtg gggcacgaag tgcgttgcaa tggtcgccac gatggcggct        60
     ctgctgtcga tgccggggac ggcactggcc caggcggccg atccaaaacc gtggcagctg       120
     aacatgggca agggggtgac ccagacctca cgcctggcct gggaatcgaa caatctctcg       180
     ctgatcgtct gtacggtgat cggcgtgatc gtgttcggcg ccatggccta cgccatgttc       240
     aagttccgca agtcgaaggg cgcggtggcc gccaccttca gccacaacac caaggccgaa       300
     atcatctgga cagtgatccc ggtgatcatc ctggtggtga tggcgtggcc ggccacggcc       360
     aacctgatca agatgtacga cacccgcgat gccgagatga cggtgaaggt caccggctac       420
     cagtggatgt ggaagtacga gtatctcggt gagaacgtca ccttcaccag ccgcctggac       480
     cgcgagtccg accgcgtgcg gcagagcggg gtcgtgccga cccgtgagag ccatccgcat       540
     tacctgctgg atgtcgacaa ccggctggtg ctgccggtcg ataccaaggt gcgcttcgtc       600
     atcacctccg acgacgtgat ccacgcctgg tgggtaccgg cactgggctg gaagcaggac       660
     gccatccccg gtttcatcaa tgaagcctgg accagcatcg agcagcccgg cgtctaccgc       720
     ggccagtgcg ccgagctgtg cggcaaggac catggcttca tgccgatcgt ggtcgaggcg       780
     gtgtccaagg aggagttcaa acagtggctg gcgcagcgca agccggcgcc gcccgctggg       840
     ccggcaacgc cggcggcacc tgccgaaccg gctgcaccgg ctgcaccggc gagcgaggca       900
     ccggctgcgc ctgctgctgc agaagcgggc agcgcacctg ccaccgctgc cagcggcgcg       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page