(data stored in ACNUC7421 zone)

EMBL: CP001111.PE311

CP001111.PE311       Location/Qualifiers
FT   CDS_pept        378139..379746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0311"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xac:XAC3887 cytochrome c oxidase subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50016"
FT                   /db_xref="GOA:B4STH3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH3"
FT                   /protein_id="ACF50016.1"
FT                   /translation="MAHSAVGHDDHHHQQSFFERWFFSTNHKDIGTLYLGFSFIMFIIG
FT                   AAMSVVIRAELAQPGLQFVKPEFFNQMTTVHALVMIFGGVMPAFVGLANWMIPLQIGAP
FT                   DMALPRMNNWSFWLLPVAFSLLLLTLFLPGGAPAGGWTLYPPLSLQGGYNVAFSVFAIH
FT                   VAGISSIMGAINIIATVLNMRAPGIDLLKMPIFCWAWLITAFLLIAVMPVLAGAVTMLL
FT                   TDKFFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGVVSEIIPTFSRKPLFGY
FT                   QAMVYATAAIAFLSFIVWAHHMFTVGMPLGGEIYFMFATMLISIPTGVKVFNWVSTMWR
FT                   GSLTFEAPMLWSVAFVILFTIGGFSGLMLAIVAADFQYHDTYFVVAHFHYVLVTGAVFA
FT                   LIAAVYYWWPKWTGRMYSEKWAKVHFWWSIVFVNLLFFPQHFLGLAGMPRRIPDYSVAF
FT                   ADWNLISSIGAFGMFATPFMMAAILLSSLRNGEKAEARSWEGARGLEWTLPSPAPAHTF
FT                   TTPPTIRPGDLAHDDISH"
     atggcgcact cggcagttgg gcacgacgat caccatcacc agcagagttt cttcgagcgt        60
     tggttcttct cgaccaacca caaggacatc ggcacgctgt acctgggctt cagcttcatc       120
     atgttcatca tcggcgcggc gatgagcgtg gtgatccggg ccgaactggc gcagccgggc       180
     ctgcagttcg tcaagcccga gttcttcaac cagatgacca ccgtgcatgc gctggtgatg       240
     atcttcggtg gcgtgatgcc ggccttcgtc ggcctcgcca actggatgat cccgctgcag       300
     atcggcgcgc cggacatggc gctgccgcgc atgaacaact ggtcgttctg gctgctgccg       360
     gtggcgttca gcctgctgct gctgaccctg ttcctgcccg gcggcgcgcc ggccggtggc       420
     tggacgctgt acccgccgct gtcgctgcag ggcggctaca acgtcgcctt cagcgtgttc       480
     gccatccatg tggccggcat cagttcgatc atgggcgcga tcaacatcat cgccaccgtg       540
     ctgaacatgc gtgcgccggg catcgatctg ctgaagatgc cgatcttctg ctgggcctgg       600
     ctgatcaccg cgttcctgct gatcgcggtg atgccggtgc tggctggcgc ggtaaccatg       660
     ctgctgaccg acaagttctt cggcaccagc ttcttcaacg ccgccggtgg cggtgacccg       720
     gtgatgtacc agcacatctt ctggttcttc gggcaccccg aggtctacat catgatcctg       780
     cccgccttcg gcgtggtcag cgagatcatc ccgaccttca gccgcaagcc gctgttcggc       840
     taccaggcga tggtgtacgc caccgcggcc atcgcgttcc tgtcgttcat cgtctgggcc       900
     caccacatgt tcaccgtggg catgccgctg ggcggcgaga tctacttcat gttcgccacc       960
     atgctgatct cgatcccgac cggcgtgaag gtgttcaact gggtcagcac catgtggcgt      1020
     ggctcgctga cgttcgaggc accgatgctg tggtcggtgg ccttcgtcat cctgttcacc      1080
     attggtggct tctccggcct gatgctggcg atcgtcgccg ccgacttcca gtaccacgat      1140
     acctacttcg tggtcgcgca cttccactac gtgctggtga ccggcgcggt gttcgcgctg      1200
     atcgccgcgg tgtactactg gtggccgaag tggaccgggc ggatgtatag cgagaagtgg      1260
     gccaaggtgc acttctggtg gtcgatcgtg ttcgtcaacc tgctgttctt cccgcagcac      1320
     ttcctcggcc tggccggcat gccgcggcgt attcccgact acagcgtggc cttcgccgac      1380
     tggaacctga tcagctcgat cggtgcgttc ggcatgttcg ccacgccgtt catgatggcc      1440
     gcgatcctgc tgtcctcgct gcgcaacggt gagaaggccg aggcccgttc ctgggaaggt      1500
     gcgcgcggcc tggaatggac gctgccgtcg ccggcgccgg cgcacacctt caccacgccg      1560
     ccgacgatcc gcccgggcga cctggcacac gacgacatca gtcattga                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page