(data stored in ACNUC7421 zone)

EMBL: CP001111.PE312

CP001111.PE312       Location/Qualifiers
FT   CDS_pept        379755..379988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xom:XOO_3918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50017"
FT                   /db_xref="GOA:B4SHH4"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH4"
FT                   /protein_id="ACF50017.1"
FT                   /translation="MHNEGPLQTCRAEPCSADALGRVEPCSTDEKQPTSGRLYQGGSIE
FT                   QQRQRARRTALWVGAIAVLVYVGFILSGVIGR"
     atgcacaacg aaggcccgct gcagacctgt agagccgagc catgctcggc tgatgccctg        60
     ggtagagtcg agccatgctc gactgacgaa aagcagccga ccagcggtcg gctctaccag       120
     ggtggaagca tcgagcagca gcgccaacgc gccaggcgca ccgcgctctg ggtcggcgcc       180
     atcgccgtgc tggtctacgt cggcttcatc ctcagcgggg tgatcggccg atga             234
//

If you have problems or comments...

PBIL Back to PBIL home page